Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1062 bp · TkA07G369830|TK1151|cDNA
ATGCCTTGGACGCCGACATCTGAGTTCCCTTCCCCCTTGGCACCAATCCCTCAAGGTGTCGGTAACTGGTTATCGTATATAAGTCTAGATCCTTTTATATGGTGGGGCATAAGAGGATATATAAACGAAATTAGAAAGAAGTTGACATTTGTCCCTGAGAGTGCTGGTAACTGGCTCTCATACATAGTCGTAGATCTTATGATTTGGTGGGGGATAAGACGATATATAAACGAACTTAGAAGGAAGTTGAATCTTGCTCC...
1062 bp · TkA07G369830|TK1151|CDS
ATGCCTTGGACGCCGACATCTGAGTTCCCTTCCCCCTTGGCACCAATCCCTCAAGGTGTCGGTAACTGGTTATCGTATATAAGTCTAGATCCTTTTATATGGTGGGGCATAAGAGGATATATAAACGAAATTAGAAAGAAGTTGACATTTGTCCCTGAGAGTGCTGGTAACTGGCTCTCATACATAGTCGTAGATCTTATGATTTGGTGGGGGATAAGACGATATATAAACGAACTTAGAAGGAAGTTGAATCTTGCTCC...
Protein
Download Protein FASTA353 aa · TkA07G369830|TK1151|PROTEIN
MPWTPTSEFPSPLAPIPQGVGNWLSYISLDPFIWWGIRGYINEIRKKLTFVPESAGNWLSYIVVDLMIWWGIRRYINELRRKLNLAPISYFSMYRGSISHFPTGYMWSPHVLPKPSDWDTLVDVVGYCFLNLGYNYQPPEDFTRWIEKGTSPIYIGFGSMPLENSKKTTDIILEALRKTGQRGVFDRGWGDLGTFSKIPDDVFLLEDYPHDWLFRQCAAVVHHGGAGTTATGLKAGCPTTIIPFFGDQHFWGEKIYHLGV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G369830 |
|---|---|
| TK1151 ID | TkA07G369830 |
| OH-1004 ID | LXL04_030008 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 92.100 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G369830 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:92691909-92697576 (+) | |||||||||
| Description | Similar to UGT80B1: Sterol 3-beta-glucosyltransferase UGT80B1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0005975 carbohydrate metabolic process Biological Process GO:0006914 autophagy Biological Process GO:0009813 flavonoid biosynthetic process Biological Process GO:0009845 seed germination Biological Process GO:0010214 seed coat development Biological Process GO:0015031 protein transport Biological Process GO:0016125 sterol metabolic process Biological Process GO:0016126 sterol biosynthetic process Biological Process GO:0048316 seed development Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005634 nucleus Cellular Component GO:0005829 cytosol Cellular Component | |||||||||
| KEGG gene cross-reference | act:ACLA_092600 ath:AT1G43620 ath:AT3G07020 ddi:DDB_G0288655 nfi:NFIA_034590 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00201UDPGT153-289 aaPF06722EryCIII-like_C195-287 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G369830 | PF00201 | UDPGT | 153 | 289 | 4.1e-06 | 26.6 |
| TkA07G369830 | PF06722 | EryCIII-like_C | 195 | 287 | 2.2e-14 | 54.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.