TkA07G369420 | RubberDandelionOmics

Gene overview

TkA07G369420

Reference: TK1151 Chr: Chr07 Coordinates: 92598400-92599000 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

534 bp · TkA07G369420|TK1151|cDNA

ATGATTGGGCGTGCGAGAACAGGGACCGGGAAAACCCTCGCTTTTGGTATTCCTATCATGGATAAGATTACTCGTTACAATAAAAAGAATGGCAATTACAGAAAAGGGCGAAACACACTAGCCATTATCCTAGCTCCGACCAGAGAACTTGCTCGCCAAGTAGAAAAAGAATTCTACGAAGCTGCACCCAATCTAGACACACTTTGCGTCTATGGAGGAGTACCAATTCAACGTCAAATGAGCACCATCGATCATGGAGT...

CDS

Download CDS FASTA

534 bp · TkA07G369420|TK1151|CDS

ATGATTGGGCGTGCGAGAACAGGGACCGGGAAAACCCTCGCTTTTGGTATTCCTATCATGGATAAGATTACTCGTTACAATAAAAAGAATGGCAATTACAGAAAAGGGCGAAACACACTAGCCATTATCCTAGCTCCGACCAGAGAACTTGCTCGCCAAGTAGAAAAAGAATTCTACGAAGCTGCACCCAATCTAGACACACTTTGCGTCTATGGAGGAGTACCAATTCAACGTCAAATGAGCACCATCGATCATGGAGT...

Protein

Download Protein FASTA

177 aa · TkA07G369420|TK1151|PROTEIN

MIGRARTGTGKTLAFGIPIMDKITRYNKKNGNYRKGRNTLAIILAPTRELARQVEKEFYEAAPNLDTLCVYGGVPIQRQMSTIDHGVDVIVGTPGRVIDLIKRGSLKLSEVKFAVLDEADQKRMGLNPTNRETDPEKPRNRPAQKPTNTGSETRKPTRSVWVAVSPQNRPKPSFVHP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G369420`
TK1151 ID	TkA07G369420
OH-1004 ID	LXL04_039027
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	57.900
Protein coverage (%)	TK1151 68.362 / OH-1004 15.653 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G369420

Location Chr07:92598400-92599000 (+)

Description Similar to RH3A: DEAD-box ATP-dependent RNA helicase 3A, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g22330`	DEAD-box ATP-dependent RNA helicase 53, mitochondrial.	No verified direct reference in this release
`At3g22310`	DEAD-box ATP-dependent RNA helicase 9, mitochondrial.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0143700`	DEAD-box ATP-dependent RNA helicase 53.	No verified direct reference in this release
`Os12g0611200`	DEAD-box ATP-dependent RNA helicase 9.	No verified direct reference in this release
`Os03g0827700`	Nuclear genome-encoded factor involved in ribosome biogenesis in chloroplasts.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039027 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000373 Group II intron splicing Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process

GO:0042254 ribosome biogenesis Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0051607 defense response to virus Biological Process

GO:2000637 positive regulation of miRNA-mediated gene silencing Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ath:AT5G26742

dosa:Os03g0827700

dosa:Os07g0143700

zma:100191761

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.495

Rank 1 · TkA07G369420 · TK1151

Nucleus0.337

Rank 2 · TkA07G369420 · TK1151

Mitochondrion0.112

Rank 3 · TkA07G369420 · TK1151

Extracellular0.080

Rank 4 · TkA07G369420 · TK1151

Cell membrane0.044

Rank 5 · TkA07G369420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00270DEAD1-121 aa

PF04851ResIII6-101 aa

PF14617CMS187-127 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G369420	`PF00270`	DEAD	1	121	6e-28	98.4
TkA07G369420	`PF04851`	ResIII	6	101	0.0007	20.3
TkA07G369420	`PF14617`	CMS1	87	127	3e-05	24.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUW5`	Arabidopsis thaliana	sp\|Q9LUW5\|RH53_ARATH DEAD-box ATP-dependent RNA helicase 53, mitochondrial	74.400%	Swiss-Prot	Medium
`Q9LUW6`	Arabidopsis thaliana	sp\|Q9LUW6\|RH9_ARATH DEAD-box ATP-dependent RNA helicase 9, mitochondrial	69.400%	Swiss-Prot	Medium
`Q0D8N0`	Oryza sativa subsp. japonica	sp\|Q0D8N0\|RH53_ORYSJ DEAD-box ATP-dependent RNA helicase 53	76.000%	Swiss-Prot	Medium
`Q0ILZ4`	Oryza sativa subsp. japonica	sp\|Q0ILZ4\|RH9_ORYSJ DEAD-box ATP-dependent RNA helicase 9	65.300%	Swiss-Prot	Medium
`Q0DM51`	Oryza sativa subsp. japonica	sp\|Q0DM51\|RH3_ORYSJ DEAD-box ATP-dependent RNA helicase 3, chloroplastic	58.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card