TkA07G367580 | RubberDandelionOmics

Gene overview

TkA07G367580

Reference: TK1151 Chr: Chr07 Coordinates: 92116933-92119226 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

690 bp · TkA07G367580|TK1151|cDNA

ATGGCGAGAACAAAGCAAACTGCTCGCAAATCAACCGGCGGAAAGGCGCCGAGAAAGCAGTTGGCCACCAAAGCCGCCCGAAAATCTGCTCCCGCAACCGGAGGAGTGAAGAAGCCGCACAGATTCAGGCCAGGAACTGTGGCACTTAGAGAGATCCGCAAGTACCAGAAGAGTACAGAGTTGTTGATTCGCAAGCTTCCATTTCAGAGGCTTGTGAGAGAAATTGCTCAAGATTTTAAGACTGATTTGAGGTTCCAGAG...

CDS

Download CDS FASTA

690 bp · TkA07G367580|TK1151|CDS

ATGGCGAGAACAAAGCAAACTGCTCGCAAATCAACCGGCGGAAAGGCGCCGAGAAAGCAGTTGGCCACCAAAGCCGCCCGAAAATCTGCTCCCGCAACCGGAGGAGTGAAGAAGCCGCACAGATTCAGGCCAGGAACTGTGGCACTTAGAGAGATCCGCAAGTACCAGAAGAGTACAGAGTTGTTGATTCGCAAGCTTCCATTTCAGAGGCTTGTGAGAGAAATTGCTCAAGATTTTAAGACTGATTTGAGGTTCCAGAG...

Protein

Download Protein FASTA

229 aa · TkA07G367580|TK1151|PROTEIN

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEASEAYLVGLFEDTNLCAIHAKRAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDMQLARRIRGERA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G367580`
TK1151 ID	TkA07G367580
OH-1004 ID	LXL04_008803
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	57.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G367580

Location Chr07:92116933-92119226 (+)

Description Similar to Histone H3.3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: P59226`	Core component of nucleosome.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008803 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0031507 heterochromatin formation Biological Process

GO:0000786 nucleosome Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0030527 structural constituent of chromatin Molecular Function

GO:0031492 nucleosomal DNA binding Molecular Function

GO:0046982 protein heterodimerization activity Molecular Function

KEGG gene cross-reference

nta:107801897

nta:107801898

nta:107810536

nta:107813079

nta:107818315

vvi:100248958

vvi:100257369

vvi:100265845

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.901

Rank 1 · TkA07G367580 · TK1151

Cytoplasm0.147

Rank 2 · TkA07G367580 · TK1151

Extracellular0.029

Rank 3 · TkA07G367580 · TK1151

Mitochondrion0.026

Rank 4 · TkA07G367580 · TK1151

Cell membrane0.016

Rank 5 · TkA07G367580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15715PAF1-58 aa

PF09072TMA714-38 aa

PF00125Histone44-117 aa

PF22329Nro1_C50-99 aa

PF21150YebU_pre-PUA_dom51-93 aa

PF29890DUF860151-104 aa

PF00808CBFD_NFYB_HMF65-110 aa

PF10303DUF240867-112 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G367580	`PF15715`	PAF	1	58	0.0027	19.2
TkA07G367580	`PF09072`	TMA7	14	38	0.11	13.9
TkA07G367580	`PF00125`	Histone	44	117	1.5e-68	227.9
TkA07G367580	`PF22329`	Nro1_C	50	99	0.092	13.5
TkA07G367580	`PF21150`	YebU_pre-PUA_dom	51	93	1.1e-05	26.0
TkA07G367580	`PF29890`	DUF8601	51	104	0.11	13.5
TkA07G367580	`PF00808`	CBFD_NFYB_HMF	65	110	0.0012	19.8
TkA07G367580	`PF10303`	DUF2408	67	112	0.031	15.6
TkA07G367580	`PF15511`	CENP-T_C	70	118	2.9e-10	40.9
TkA07G367580	`PF15630`	CENP-S	71	118	7.6e-07	30.2
TkA07G367580	`PF30905`	PGRL1_N	78	101	0.28	12.3
TkA07G367580	`PF08589`	ATG43	82	103	0.11	14.1
TkA07G367580	`PF02291`	TFIID-31kDa	85	119	0.14	12.9
TkA07G367580	`PF24310`	THSD1_D2	94	116	0.02	15.6
TkA07G367580	`PF25745`	Phage_GP58	99	112	0.018	15.5
TkA07G367580	`PF09072`	TMA7	115	131	0.11	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P59226`	Arabidopsis thaliana	sp\|P59226\|H31_ARATH Histone H3.1	99.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card