TkA07G367070 | RubberDandelionOmics

Gene overview

TkA07G367070

Reference: TK1151 Chr: Chr07 Coordinates: 91964787-91967427 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2129 bp · TkA07G367070|TK1151|cDNA

GATCTCTCACCAATCCGAAACCCTTATTTCATCCGCATAGCAAATCCTTCCTCAACACAAGCCCAACCCATTGCAGCTCTAGTCAAGTCCTTTGGCTGGAGGGAAGTTGTGTTTGTTTACGAAGATACTGATTTCGGAAGGGGGCCCATTCCCTTTTTATTTGACGCCATGGTCAACATCAGCACTCAGGTGAAGTATCGTGCTCTTTTGCCTCTAACCTCGTCGGATGACAGGATTCTTCAAGAACTTTACAAATTAAA...

CDS

Download CDS FASTA

2040 bp · TkA07G367070|TK1151|CDS

CTCTCACCAATCCGAAACCCTTATTTCATCCGCATAGCAAATCCTTCCTCAACACAAGCCCAACCCATTGCAGCTCTAGTCAAGTCCTTTGGCTGGAGGGAAGTTGTGTTTGTTTACGAAGATACTGATTTCGGAAGGGGGCCCATTCCCTTTTTATTTGACGCCATGGTCAACATCAGCACTCAGGTGAAGTATCGTGCTCTTTTGCCTCTAACCTCGTCGGATGACAGGATTCTTCAAGAACTTTACAAATTAAAGAC...

Protein

Download Protein FASTA

680 aa · TkA07G367070|TK1151|PROTEIN

LSPIRNPYFIRIANPSSTQAQPIAALVKSFGWREVVFVYEDTDFGRGPIPFLFDAMVNISTQVKYRALLPLTSSDDRILQELYKLKTMQTRVFVVHMLPDLASRFFKKAYEAGMMGQGYAWIITDVLTGLLHQLDPKTIDCMHGVLGVKPYIPPSTHLTNFEKRWRKMFQKEYPDIGRFELDMFGIWSYDVVARLVMALKRGESETQLSNNFKRPRKASTDLAAIGISKMGSRLLPMIRNVSLKGISGDFLVVNGQLRTY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G367070`
TK1151 ID	TkA07G367070
OH-1004 ID	LXL04_029987
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 70.833 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G367070

Location Chr07:91964787-91967427 (+)

Description Similar to GLR2.7: Glutamate receptor 2.7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g29120`	Glutamate-gated receptor that probably acts as a non-selective cation channel.	No verified direct reference in this release
`At2g29100`	Glutamate-gated receptor that probably acts as a non-selective cation channel.	No verified direct reference in this release
`At2g29110`	Glutamate-gated receptor that probably acts as a non-selective cation channel.	No verified direct reference in this release
`At5g11180`	Glutamate-gated receptor that probably acts as a non-selective cation channel.	No verified direct reference in this release
`At2g24720`	Glutamate-gated receptor that probably acts as a non-selective cation channel.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029987 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006816 calcium ion transport Biological Process

GO:0006874 intracellular calcium ion homeostasis Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0019722 calcium-mediated signaling Biological Process

GO:0071230 cellular response to amino acid stimulus Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005262 calcium channel activity Molecular Function

GO:0008066 glutamate receptor activity Molecular Function

GO:0015276 ligand-gated monoatomic ion channel activity Molecular Function

GO:0038023 signaling receptor activity Molecular Function

KEGG gene cross-reference

ath:AT2G24720

ath:AT2G29100

ath:AT2G29110

ath:AT2G29120

ath:AT5G27100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.866

Rank 1 · TkA07G367070 · TK1151

Cytoplasm0.076

Rank 2 · TkA07G367070 · TK1151

Endoplasmic reticulum0.059

Rank 3 · TkA07G367070 · TK1151

Nucleus0.025

Rank 4 · TkA07G367070 · TK1151

Lysosome / Vacuole0.025

Rank 5 · TkA07G367070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13458Peripla_BP_65-200 aa

PF01094ANF_receptor7-269 aa

PF10613Lig_chan-Glu_bd350-438 aa

PF00497SBP_bac_3355-676 aa

PF00060Lig_chan456-560 aa

PF19667DUF6170508-551 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G367070	`PF13458`	Peripla_BP_6	5	200	4e-08	34.0
TkA07G367070	`PF01094`	ANF_receptor	7	269	5.7e-49	167.8
TkA07G367070	`PF10613`	Lig_chan-Glu_bd	350	438	8.8e-12	45.9
TkA07G367070	`PF00497`	SBP_bac_3	355	676	2.1e-11	44.4
TkA07G367070	`PF00060`	Lig_chan	456	560	1.5e-32	113.1
TkA07G367070	`PF19667`	DUF6170	508	551	0.2	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LGN0`	Arabidopsis thaliana	sp\|Q8LGN0\|GLR27_ARATH Glutamate receptor 2.7	46.500%	Swiss-Prot	Medium
`O81078`	Arabidopsis thaliana	sp\|O81078\|GLR29_ARATH Glutamate receptor 2.9	44.500%	Swiss-Prot	Medium
`Q9C5V5`	Arabidopsis thaliana	sp\|Q9C5V5\|GLR28_ARATH Glutamate receptor 2.8	45.100%	Swiss-Prot	Medium
`Q9LFN8`	Arabidopsis thaliana	sp\|Q9LFN8\|GLR26_ARATH Glutamate receptor 2.6	43.400%	Swiss-Prot	Medium
`Q9SHV1`	Arabidopsis thaliana	sp\|Q9SHV1\|GLR22_ARATH Glutamate receptor 2.2	44.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card