TkA07G363820 | RubberDandelionOmics

Gene overview

TkA07G363820

Reference: TK1151 Chr: Chr07 Coordinates: 91181178-91182656 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1291 bp · TkA07G363820|TK1151|cDNA

GAGAGAGTATGCCATTTTAGCATGCATTATGTTTGCTTACATGAATAATTTCAGCTATATAAAGGATGGAGAAGTAGGCTCAAAATCACAACTTGGATCCATTTCTCTAGTAGAAATGGGAACGAAAGCGAAAATGCCTCAAATGAGCACCCTTCTAGTGAGTCTTGCTGTGGTTATTATTTCCTTATACTTGCCGTTGTTTGCCACAGCCACTTACCCCTACTCGTATCCACCACCCCCTAAGCATGAATATGTTTACA...

CDS

Download CDS FASTA

942 bp · TkA07G363820|TK1151|CDS

ATGTTTGCTTACATGAATAATTTCAGCTATATAAAGGATGGAGAAGTAGGCTCAAAATCACAACTTGGATCCATTTCTCTAGTAGAAATGGGAACGAAAGCGAAAATGCCTCAAATGAGCACCCTTCTAGTGAGTCTTGCTGTGGTTATTATTTCCTTATACTTGCCGTTGTTTGCCACAGCCACTTACCCCTACTCGTATCCACCACCCCCTAAGCATGAATATGTTTACAAGTCATCACCACCTCCACCAAAAAAACA...

Protein

Download Protein FASTA

313 aa · TkA07G363820|TK1151|PROTEIN

MFAYMNNFSYIKDGEVGSKSQLGSISLVEMGTKAKMPQMSTLLVSLAVVIISLYLPLFATATYPYSYPPPPKHEYVYKSSPPPPKKHYIYKSPPPPHHTHKSPPPPPPKNPYIYKSPPCPPKKHDVYKSPPHHPPKKHYLYKSPPPPPVHKSPPPPPPKKPYIYKSPPPPPPVHKSPPPPPSKEPYIYKSPPPPPPKKHYLYKSPPPPPPIHKSPPPPPPKKPYVYKSPPPPPPKKYYLYKSPPPPPPVHKSPPPPPPKK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G363820`
TK1151 ID	TkA07G363820
OH-1004 ID	LXL04_029969
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 47.604 / OH-1004 46.417 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G363820`
Location	Chr07:91181178-91182656 (-)
Description	Similar to EXT3: Extensin-3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_029969` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009664 plant-type cell wall organization Biological Process GO:0009530 primary cell wall Cellular Component GO:0005199 structural constituent of cell wall Molecular Function
KEGG gene cross-reference	ath:AT1G21310 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.795

Rank 1 · TkA07G363820 · TK1151

Endoplasmic reticulum0.102

Rank 2 · TkA07G363820 · TK1151

Cell membrane0.076

Rank 3 · TkA07G363820 · TK1151

Cytoplasm0.042

Rank 4 · TkA07G363820 · TK1151

Nucleus0.019

Rank 5 · TkA07G363820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04554Extensin_264-120 aa

PF04554Extensin_2100-147 aa

PF04554Extensin_2121-170 aa

PF04554Extensin_2150-194 aa

PF04554Extensin_2169-231 aa

PF04554Extensin_2210-270 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G363820	`PF04554`	Extensin_2	64	120	1.2e-07	32.4
TkA07G363820	`PF04554`	Extensin_2	100	147	1.2e-07	32.4
TkA07G363820	`PF04554`	Extensin_2	121	170	1.2e-07	32.4
TkA07G363820	`PF04554`	Extensin_2	150	194	1.2e-07	32.4
TkA07G363820	`PF04554`	Extensin_2	169	231	1.2e-07	32.4
TkA07G363820	`PF04554`	Extensin_2	210	270	1.2e-07	32.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card