TkA07G362380 | RubberDandelionOmics

Gene overview

TkA07G362380

Reference: TK1151 Chr: Chr07 Coordinates: 90776663-90782507 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1364 bp · TkA07G362380|TK1151|cDNA

TGAGCCGTTACACCCGAACAACAGGAGTTTCCCTTAAATCCTTCTCCATTGAACGAAACGTTCCCCAGTTAAATGCCTAAAATTGTTTTTCCATAACAATGCACACAGTCGTAGTCGTTACACAAGAGAACATAAATCACTGTCGTAATGTTCTCCATACATAACAAAGCGACGACCACGACGGTGGAGGACTGTTGTGTGAAGGTAGCGGTACATATTCGACCGCTTATCGGAGATGAGAAGCTTCAAGCTTGTCAAGA...

CDS

Download CDS FASTA

750 bp · TkA07G362380|TK1151|CDS

ATGTTCTCCATACATAACAAAGCGACGACCACGACGGTGGAGGACTGTTGTGTGAAGGTAGCGGTACATATTCGACCGCTTATCGGAGATGAGAAGCTTCAAGCTTGTCAAGATTGTGTAGCTGTTGTACCGAGAAACCCCCAGGTGCAACTTGGTACACATTCCTTCACTTTCGATCATGTCTATGGAAGCTCCGGTTCCCCATCATCCGCCATGTTTGAAGACTGCGTTTCTCCCCTTGTTGACGGTCTATTTCAAGG...

Protein

Download Protein FASTA

249 aa · TkA07G362380|TK1151|PROTEIN

MFSIHNKATTTTVEDCCVKVAVHIRPLIGDEKLQACQDCVAVVPRNPQVQLGTHSFTFDHVYGSSGSPSSAMFEDCVSPLVDGLFQGYNATDLAYGQTGSGKTYTMGTGFKDGYQAWLIRQAMTALFNKIETLQDQIEFQLHVSFIEVLRERISWLEATNQDLCRELHEYRSRGVAVDQSSTKAVDSFCVNNEGIKRSLQSINSSDYQMSENAYITYLYAILQRTLLQCPRCSTPDPTPSAIELNSNAI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G362380`
TK1151 ID	TkA07G362380
OH-1004 ID	LXL04_031709
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	41.900
Protein coverage (%)	TK1151 82.329 / OH-1004 44.844 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G362380

Location Chr07:90776663-90782507 (+)

Description Similar to KIN4A: Kinesin-like protein KIN-4A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47820`	Kinesin-like motor protein involved in the control of the oriented deposition of cellulose microfibrils.	A kinesin-like protein is essential for oriented deposition of cellulose microfibrils and cell wall strength.2002 · DOI: 10.1105/tpc.005801 Single molecule analysis of the Arabidopsis FRA1 kinesin shows that it is a functional motor protein with unusually high processivity.2011 · DOI: 10.1093/mp/ssr077 Kinesin-4 Functions in Vesicular Transport on Cortical Microtubules and Regulates Cell Wall Mechanics during Cell Elongation in Plants.2015 · DOI: 10.1016/j.molp.2015.01.004
`At3g50240`	Kinesin-like motor protein involved in the control of the oriented deposition of cellulose microfibrils.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0114500`	Microtubule-dependent motor protein involved in the control of the oriented deposition of cellulose microfibrils.	Mutation of rice BC12/GDD1, which encodes a kinesin-like protein that binds to a GA biosynthesis gene promoter, leads to dwarfism with impaired cell elongation.2011 · DOI: 10.1105/tpc.110.081901
`UniProt: B9F2Y7`	Microtubule-dependent motor protein involved in the control of the oriented deposition of cellulose microfibrils.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031709 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0007018 microtubule-based movement Biological Process

GO:0007052 mitotic spindle organization Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0009937 regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0010215 cellulose microfibril organization Biological Process

GO:0030705 cytoskeleton-dependent intracellular transport Biological Process

GO:0042127 regulation of cell population proliferation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0051231 spindle elongation Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G50240

ath:AT5G47820

ath:AT5G60930

dosa:Os09g0114500

ghi:107917911

osa:4346402

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.586

Rank 1 · TkA07G362380 · TK1151

Nucleus0.398

Rank 2 · TkA07G362380 · TK1151

Mitochondrion0.100

Rank 3 · TkA07G362380 · TK1151

Cell membrane0.060

Rank 4 · TkA07G362380 · TK1151

Golgi apparatus0.049

Rank 5 · TkA07G362380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00225Kinesin25-209 aa

PF16796Microtub_bd43-153 aa

PF09544DUF2381131-202 aa

PF11365SOGA141-201 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G362380	`PF00225`	Kinesin	25	209	1.4e-28	100.5
TkA07G362380	`PF16796`	Microtub_bd	43	153	7.8e-16	59.1
TkA07G362380	`PF09544`	DUF2381	131	202	0.32	11.0
TkA07G362380	`PF11365`	SOGA	141	201	0.039	15.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GS71`	Arabidopsis thaliana	sp\|Q8GS71\|KN4A_ARATH Kinesin-like protein KIN-4A	71.700%	Swiss-Prot	Medium
`Q94LW7`	Arabidopsis thaliana	sp\|Q94LW7\|KN4B_ARATH Kinesin-like protein KIN-4B	72.100%	Swiss-Prot	Medium
`Q6YUL8`	Oryza sativa subsp. japonica	sp\|Q6YUL8\|KN4A_ORYSJ Kinesin-like protein KIN-4A	73.600%	Swiss-Prot	Medium
`B9F2Y7`	Oryza sativa subsp. japonica	sp\|B9F2Y7\|KN4C_ORYSJ Kinesin-like protein KIN-4C	58.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card