TkA07G360780 | RubberDandelionOmics

Gene overview

TkA07G360780

Reference: TK1151 Chr: Chr07 Coordinates: 90406314-90409300 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1373 bp · TkA07G360780|TK1151|cDNA

TAATAACTCAAAGCAATTGCGTGACCACGTATCCCACATTATCCATCAAACAGGAGGCTCCACGTAAACGAGTGGTGCCTCTGCGTTCCCATGGATTTTCGATAGGCTCCACAGTAACAAAACACCTACCAACGATTTCAGAAACTCAAAATACTCGAAATTATAGGGTTCTCTAATGATTTTCATCTTCAAAATTCCCACACACCACACACCTCTTTCGCCTCTCTTTTCTCTGAGATTAGTAGAGTGAGTGGTGATGA...

CDS

Download CDS FASTA

759 bp · TkA07G360780|TK1151|CDS

ATGTTGTCTATGGCAAGCAGAAATCTTTCATTAACATCTCTTCACAGGAATCCGTACACTTGTTTCAGTTGCAGCTTAAACCCTTCAAGAAGACATTCCCCTAATTCTGGATTTCTTCCCGACACTCGACCTTCTTACAATACCCTCGTTTACCAGGCAGTGAAACTTTTAGGCCCTCCGGCGACATTTTACCCTTCAAAACTTAAGGTTGTTTTCAAGGGAGAAGAAACCGATCAATACACACGAATTCTCCCAAGAAC...

Protein

Download Protein FASTA

252 aa · TkA07G360780|TK1151|PROTEIN

MLSMASRNLSLTSLHRNPYTCFSCSLNPSRRHSPNSGFLPDTRPSYNTLVYQAVKLLGPPATFYPSKLKVVFKGEETDQYTRILPRTYNLSHCDFTADLTLTISNVIDHDQLRGWHNKDDVVARWAEVKGHMCLDVHCYVSGPNSWLDLVSEFRYYIFAKELPLVLEAMLYGDRVLFSQHKELMDAFVRVFFHSSSRKYNRVECWGPLKDAAKGRVGDQMQGLFGGKMEPSAIPRDTGLPKSIFQLLVTFLL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G360780`
TK1151 ID	TkA07G360780
OH-1004 ID	LXL04_029939
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G360780

Location Chr07:90406314-90409300 (-)

Description Similar to SGRL: Magnesium dechelatase SGRL, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g44000`	Magnesium chelatase involved in chlorophyll a degradation in the chlorophyll-protein complexes of photosystem I (PSI) and photosystem II (PSII).	Arabidopsis STAYGREEN-LIKE (SGRL) promotes abiotic stress-induced leaf yellowing during vegetative growth.2014 · DOI: 10.1016/j.febslet.2014.09.018 Arabidopsis STAY-GREEN , Mendel's Green Cotyledon Gene, Encodes Magnesium-Dechelatase.2016 · DOI: 10.1105/tpc.16.00428

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2Z3E5`	Involved in the disassembling mechanism of the intact light-harvesting complex of photosystem II (LHCPII) in the thylakoid membranes.	No verified direct reference in this release
`Os09g0532000`	Involved in the disassembling mechanism of the intact light-harvesting complex of photosystem II (LHCII) in the thylakoid membranes.	No verified direct reference in this release
`Os04g0692600`	Promotes chlorophyll degradation in leaves.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029939 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0010271 regulation of chlorophyll catabolic process Biological Process

GO:0015996 chlorophyll catabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0016829 lyase activity Molecular Function

KEGG gene cross-reference

ath:AT1G44000

cann:107866321

dosa:Os09g0532000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.495

Rank 1 · TkA07G360780 · TK1151

Mitochondrion0.228

Rank 2 · TkA07G360780 · TK1151

Nucleus0.162

Rank 3 · TkA07G360780 · TK1151

Cytoplasm0.097

Rank 4 · TkA07G360780 · TK1151

Endoplasmic reticulum0.054

Rank 5 · TkA07G360780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12638Staygreen63-211 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G360780	`PF12638`	Staygreen	63	211	1e-54	185.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94AQ9`	Arabidopsis thaliana	sp\|Q94AQ9\|SGRL_ARATH Magnesium dechelatase SGRL, chloroplastic	53.300%	Swiss-Prot	High
`A2Z3E5`	Oryza sativa subsp. indica	sp\|A2Z3E5\|SGR_ORYSI Protein STAY-GREEN, chloroplastic	55.100%	Swiss-Prot	Medium
`Q652K1`	Oryza sativa subsp. japonica	sp\|Q652K1\|SGR_ORYSJ Protein STAY-GREEN, chloroplastic	55.100%	Swiss-Prot	Medium
`Q0J8Q3`	Oryza sativa subsp. japonica	sp\|Q0J8Q3\|SGRL_ORYSJ Protein STAY-GREEN LIKE, chloroplastic	32.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card