TkA07G360100 | RubberDandelionOmics

Gene overview

TkA07G360100

Reference: TK1151 Chr: Chr07 Coordinates: 90201479-90203616 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1936 bp · TkA07G360100|TK1151|cDNA

CAAATTTATAGTTTACACATCACGTTCAGGCATTTTGATATCAATGGCGACCACCATTAGAATTACAAAAACGCCCTCCTCTCATCCTCGACTTTTTCTTCCTTCGAAACTTCATTGTTGCTCAAAAACAATGAACCACTACAACCACAGATGACAACCAGGTGAGATATTGTGTTCATGATCTACTTCTTGTGCCGAATCACGGTGGGTTTAGCTTCAAAGTTCAGTTTCTACGCCTTCTTCAAAGTTTCAAGTGCTCA...

CDS

Download CDS FASTA

741 bp · TkA07G360100|TK1151|CDS

ATGGGAGTCTATGATATGTCTGCTCATGAATGGCGTGGAAGAGAAATCGAGTGTTTACGAAATCAACGGGAACAAATAAGTAAAAAAATTAGGTATCTGGGTGTTCGATTTCATTCGTTTAATTTCACAATTGAATTCTATCGATCAGTTTTTCTAGTCAAAATCGGTTCAGTCCCAAAACGTTCACCAAAAAGGGTTCGATCCACAATTAAACTCGATGAGCTGGATGGTATAAGCTCAAAATGGATCGATTCAGACAT...

Protein

Download Protein FASTA

246 aa · TkA07G360100|TK1151|PROTEIN

MGVYDMSAHEWRGREIECLRNQREQISKKIRYLGVRFHSFNFTIEFYRSVFLVKIGSVPKRSPKRVRSTIKLDELDGISSKWIDSDILVFNTGHWWNRAKLFELGCYFKVGGRLKLGMSTMSAYTTALQTWASWVENMVDTDRTHVFFRTFEGSHWSGKNGHTCEVTEKPIYKSNMEYRSHFSDIIKEVVDNMSVPVTAMHVTPMGSYRSDAHVGTWSDNPTVPDCSHWCLPGVPDAWNQILFSYL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G360100`
TK1151 ID	TkA07G360100
OH-1004 ID	LXL04_029926
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.400
Protein coverage (%)	TK1151 90.244 / OH-1004 47.017 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G360100

Location Chr07:90201479-90203616 (-)

Description Similar to TBL7: Protein trichome berefringence-like 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g48880`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At3g11570`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At5g06230`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At3g06080`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At5g19160`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029926 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007623 circadian rhythm Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0008374 O-acyltransferase activity Molecular Function

GO:0016413 O-acetyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G48880

ath:AT3G06080

ath:AT3G11570

ath:AT5G06230

ath:AT5G19160

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.198

Rank 1 · TkA07G360100 · TK1151

Extracellular0.169

Rank 2 · TkA07G360100 · TK1151

Cell membrane0.073

Rank 3 · TkA07G360100 · TK1151

Endoplasmic reticulum0.061

Rank 4 · TkA07G360100 · TK1151

Plastid0.057

Rank 5 · TkA07G360100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13839PC-Esterase23-244 aa

PF01641SelR161-231 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G360100	`PF13839`	PC-Esterase	23	244	6.9e-65	220.5
TkA07G360100	`PF01641`	SelR	161	231	0.12	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I037`	Arabidopsis thaliana	sp\|F4I037\|TBL7_ARATH Protein trichome berefringence-like 7	59.300%	Swiss-Prot	High
`Q9CAX1`	Arabidopsis thaliana	sp\|Q9CAX1\|TBL8_ARATH Protein trichome birefringence-like 8	41.500%	Swiss-Prot	Medium
`Q9FFZ4`	Arabidopsis thaliana	sp\|Q9FFZ4\|TBL9_ARATH Protein trichome birefringence-like 9	38.800%	Swiss-Prot	Medium
`Q9LDG2`	Arabidopsis thaliana	sp\|Q9LDG2\|TBL10_ARATH Protein trichome birefringence-like 10	39.100%	Swiss-Prot	Medium
`Q5BPJ0`	Arabidopsis thaliana	sp\|Q5BPJ0\|TBL11_ARATH Protein trichome birefringence-like 11	36.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card