TkA07G359060 | RubberDandelionOmics

Gene overview

TkA07G359060

Reference: TK1151 Chr: Chr07 Coordinates: 89964138-89967912 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1951 bp · TkA07G359060|TK1151|cDNA

TAATAACACACTGAACTTATAAGCATTAGCCCTCAATATACGTAGTACTCAATCTCCAAAGACATATATATAAACATAGGGATCCAATGTCAAACCGGATGCAACATGACACACGAGATAATCGCATTTCAGCTATCGATCAGAGTGGAATTGCAACTCCAGTTGGTAGTAGCAAAGACTATGATCATCAAGAGATGAACACTAACCAGGATAATTCTCATAAGCCTGGATGGAGAAATTTCCTGTCGTTTGTTGGCCCT...

CDS

Download CDS FASTA

1644 bp · TkA07G359060|TK1151|CDS

ATGTCAAACCGGATGCAACATGACACACGAGATAATCGCATTTCAGCTATCGATCAGAGTGGAATTGCAACTCCAGTTGGTAGTAGCAAAGACTATGATCATCAAGAGATGAACACTAACCAGGATAATTCTCATAAGCCTGGATGGAGAAATTTCCTGTCGTTTGTTGGCCCTGGTTTCCTAGTTTCATTAGCTTATCTCGATCCTGGAAACTTGGAAACTGATTTACAAGCAGGAGCAAACCACAGATTCGAGCTACT...

Protein

Download Protein FASTA

547 aa · TkA07G359060|TK1151|PROTEIN

MSNRMQHDTRDNRISAIDQSGIATPVGSSKDYDHQEMNTNQDNSHKPGWRNFLSFVGPGFLVSLAYLDPGNLETDLQAGANHRFELLWVILIGLIFALVIQSLAANLGVCTGKHLSEVCKAEYPLFVKYCLWVLAEIAVIAADIPEVIGTAFALNILFNIPVWVGVLLTGFSTLLFLGIQRYGVRKLEVLIAILVLVMAGCFFGEMSYVKPPASDVLKGMFIPKLGGRGATGDAIALLGALVMPHNLFLHSALVLSRKIP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G359060`
TK1151 ID	TkA07G359060
OH-1004 ID	LXL04_029911
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.269 / OH-1004 84.977 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G359060

Location Chr07:89964138-89967912 (+)

Description Similar to NRAMP5: Metal transporter Nramp5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0257200`	Probable metal transporter.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029911 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006828 manganese ion transport Biological Process

GO:0006879 intracellular iron ion homeostasis Biological Process

GO:0030026 intracellular manganese ion homeostasis Biological Process

GO:0034755 iron ion transmembrane transport Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0005384 manganese ion transmembrane transporter activity Molecular Function

KEGG gene cross-reference

dosa:Os07g0257200

pop:18096211

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.422

Rank 1 · TkA07G359060 · TK1151

Cell membrane0.352

Rank 2 · TkA07G359060 · TK1151

Cytoplasm0.150

Rank 3 · TkA07G359060 · TK1151

Endoplasmic reticulum0.105

Rank 4 · TkA07G359060 · TK1151

Golgi apparatus0.097

Rank 5 · TkA07G359060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01566Nramp59-457 aa

PF13567DUF413187-98 aa

PF13567DUF4131159-205 aa

PF01566Nramp474-490 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G359060	`PF01566`	Nramp	59	457	2.1e-125	419.5
TkA07G359060	`PF13567`	DUF4131	87	98	1.0	9.7
TkA07G359060	`PF13567`	DUF4131	159	205	1.0	9.7
TkA07G359060	`PF01566`	Nramp	474	490	2.1e-125	419.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H4H5`	Oryza sativa subsp. japonica	sp\|Q8H4H5\|NRAM5_ORYSJ Metal transporter Nramp5	71.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card