TkA07G356950 | RubberDandelionOmics

Gene overview

TkA07G356950

Reference: TK1151 Chr: Chr07 Coordinates: 89403954-89404379 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

426 bp · TkA07G356950|TK1151|cDNA

ATGCTTTTATCCGGTGTCGAACCAAACTCTTATACTTTTCCTCCTCTTTTTAAATCTTGTGCAAGAATCGAGGGGATAAACGAAGGGAAACATATTCACGGACATGTTTTGAAGCTTGGACTTGGTTGTGATGTGTTCACTCACACCTCATTAATCAATTTTTATTCTCAAAGTGGAGAATTGGATGATGCGAGATTAGTCCTCTTTAATGAATGTCGTCGATGTTTCTTACCTCAATTTTCTGAAATGGGATTTAACAA...

CDS

Download CDS FASTA

426 bp · TkA07G356950|TK1151|CDS

ATGCTTTTATCCGGTGTCGAACCAAACTCTTATACTTTTCCTCCTCTTTTTAAATCTTGTGCAAGAATCGAGGGGATAAACGAAGGGAAACATATTCACGGACATGTTTTGAAGCTTGGACTTGGTTGTGATGTGTTCACTCACACCTCATTAATCAATTTTTATTCTCAAAGTGGAGAATTGGATGATGCGAGATTAGTCCTCTTTAATGAATGTCGTCGATGTTTCTTACCTCAATTTTCTGAAATGGGATTTAACAA...

Protein

Download Protein FASTA

141 aa · TkA07G356950|TK1151|PROTEIN

MLLSGVEPNSYTFPPLFKSCARIEGINEGKHIHGHVLKLGLGCDVFTHTSLINFYSQSGELDDARLVLFNECRRCFLPQFSEMGFNKIRYKYKSTSIKKNPHERTVCFHFHVNKLKLQISCLCPHGSVKYRNSVSFEHEFV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G356950`
TK1151 ID	TkA07G356950
OH-1004 ID	LXL04_028031
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.000
Protein coverage (%)	TK1151 47.518 / OH-1004 9.203 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G356950

Location Chr07:89403954-89404379 (+)

Description Similar to PCMP-H12: Pentatricopeptide repeat-containing protein At1g08070, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g15930`	Putative pentatricopeptide repeat-containing protein At3g15930.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028031 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0009451 RNA modification Biological Process

GO:0031425 chloroplast RNA processing Biological Process

GO:0080156 mitochondrial mRNA modification Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G08070

ath:AT2G29760

ath:AT3G12770

ath:AT3G23330

ath:AT4G14820

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.539

Rank 1 · TkA07G356950 · TK1151

Cytoplasm0.156

Rank 2 · TkA07G356950 · TK1151

Nucleus0.129

Rank 3 · TkA07G356950 · TK1151

Plastid0.111

Rank 4 · TkA07G356950 · TK1151

Cell membrane0.025

Rank 5 · TkA07G356950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13041PPR_21-22 aa

PF12854PPR_15-13 aa

PF13812PPR_35-20 aa

PF13812PPR_338-67 aa

PF12854PPR_140-65 aa

PF13041PPR_244-65 aa

PF01535PPR46-67 aa

PF24337DUF750552-86 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G356950	`PF13041`	PPR_2	1	22	2.8e-05	24.8
TkA07G356950	`PF12854`	PPR_1	5	13	2.1e-05	24.9
TkA07G356950	`PF13812`	PPR_3	5	20	0.12	13.2
TkA07G356950	`PF13812`	PPR_3	38	67	0.12	13.2
TkA07G356950	`PF12854`	PPR_1	40	65	2.1e-05	24.9
TkA07G356950	`PF13041`	PPR_2	44	65	2.8e-05	24.8
TkA07G356950	`PF01535`	PPR	46	67	0.016	16.1
TkA07G356950	`PF24337`	DUF7505	52	86	0.074	13.4
TkA07G356950	`PF24337`	DUF7505	103	139	0.074	13.4
TkA07G356950	`PF12854`	PPR_1	119	128	2.1e-05	24.9
TkA07G356950	`PF01535`	PPR	119	128	0.016	16.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LSB8`	Arabidopsis thaliana	sp\|Q9LSB8\|PP235_ARATH Putative pentatricopeptide repeat-containing protein At3g15930	36.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card