TkA07G355550 | RubberDandelionOmics

Gene overview

TkA07G355550

Reference: TK1151 Chr: Chr07 Coordinates: 89007619-89008822 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

610 bp · TkA07G355550|TK1151|cDNA

TTTTGCAGAGATGAGCGAAGAGGGGAAGAGATCTCCGGCGAATGCTACGTTTCCGGCTAAGCCTCCGTTTACGGGGGATGATCGGAAAATTACCGCATCTTCGTTATCGACATCTACTTCCAGCAGCAGGAAAGTCGTCATCAAGAGTGCCGATATGAAGGAAGAAATGCAAAACGAAGCCGTCAATATTGCCATTTCCGCGTTTGAGAATTGCAGCGTGGAGAAGGATGTCGCGGAACAGATAAAGAAGGAGTTCGATA...

CDS

Download CDS FASTA

378 bp · TkA07G355550|TK1151|CDS

ATGAGCGAAGAGGGGAAGAGATCTCCGGCGAATGCTACGTTTCCGGCTAAGCCTCCGTTTACGGGGGATGATCGGAAAATTACCGCATCTTCGTTATCGACATCTACTTCCAGCAGCAGGAAAGTCGTCATCAAGAGTGCCGATATGAAGGAAGAAATGCAAAACGAAGCCGTCAATATTGCCATTTCCGCGTTTGAGAATTGCAGCGTGGAGAAGGATGTCGCGGAACAGATAAAGAAGGAGTTCGATAAGAATCACGG...

Protein

Download Protein FASTA

125 aa · TkA07G355550|TK1151|PROTEIN

MSEEGKRSPANATFPAKPPFTGDDRKITASSLSTSTSSSRKVVIKSADMKEEMQNEAVNIAISAFENCSVEKDVAEQIKKEFDKNHGPTWHCIVGKNFGSYVTHETNHFVYFYLESKAVLLFKSG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G355550`
TK1151 ID	TkA07G355550
OH-1004 ID	LXL04_029877
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G355550`
Location	Chr07:89007619-89008822 (-)
Description	Similar to ctp: Dynein light chain 1, cytoplasmic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_029877` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000132 establishment of mitotic spindle orientation Biological Process GO:0003341 cilium movement Biological Process GO:0007017 microtubule-based process Biological Process GO:0007283 spermatogenesis Biological Process GO:0007290 spermatid nucleus elongation Biological Process GO:0007291 sperm individualization Biological Process GO:0030317 flagellated sperm motility Biological Process GO:0031507 heterochromatin formation Biological Process GO:0034454 microtubule anchoring at centrosome Biological Process GO:0044458 motile cilium assembly Biological Process GO:0051017 actin filament bundle assembly Biological Process GO:0141006 transposable element silencing by piRNA-mediated heterochromatin formation Biological Process
KEGG gene cross-reference	cre:CHLRE_03g181150v5 dme:Dmel_CG5450 dme:Dmel_CG6998 mmu:68097 rno:140734 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.647

Rank 1 · TkA07G355550 · TK1151

Nucleus0.410

Rank 2 · TkA07G355550 · TK1151

Cell membrane0.102

Rank 3 · TkA07G355550 · TK1151

Mitochondrion0.058

Rank 4 · TkA07G355550 · TK1151

Endoplasmic reticulum0.053

Rank 5 · TkA07G355550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21471Reelin_subrepeat-B34-118 aa

PF02224Cytidylate_kin36-108 aa

PF03230Antirestrict38-76 aa

PF01221Dynein_light41-124 aa

PF03230Antirestrict86-106 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G355550	`PF21471`	Reelin_subrepeat-B	34	118	0.052	14.0
TkA07G355550	`PF02224`	Cytidylate_kin	36	108	0.096	13.1
TkA07G355550	`PF03230`	Antirestrict	38	76	0.29	12.0
TkA07G355550	`PF01221`	Dynein_light	41	124	1.3e-38	132.0
TkA07G355550	`PF03230`	Antirestrict	86	106	0.29	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card