TkA07G354640 | RubberDandelionOmics

Gene overview

TkA07G354640

Reference: TK1151 Chr: Chr07 Coordinates: 88742678-88743191 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

315 bp · TkA07G354640|TK1151|cDNA

ATGGAACTCAGGGGTTTATTCCAGTATCTGGTAAATCAGTTAAAAAAAGGAAGTGGGATTGAGCTTTTTCTTCTGCAGGAACTTATCCAGCAAATGGCTAATGTCCAGTACACAGAGAACATGACTGAAGAGCAGTTGGATGCTATGGCAGGAAGTGAGACTCTCCGATATCAGGCTACTTATTTTGGGGCTACCCGCAACAATAAGACTCTAATCAAATCCACCAACAGGCTACGTGATTCCTTGCTTCCCAAGGATGA...

CDS

Download CDS FASTA

315 bp · TkA07G354640|TK1151|CDS

ATGGAACTCAGGGGTTTATTCCAGTATCTGGTAAATCAGTTAAAAAAAGGAAGTGGGATTGAGCTTTTTCTTCTGCAGGAACTTATCCAGCAAATGGCTAATGTCCAGTACACAGAGAACATGACTGAAGAGCAGTTGGATGCTATGGCAGGAAGTGAGACTCTCCGATATCAGGCTACTTATTTTGGGGCTACCCGCAACAATAAGACTCTAATCAAATCCACCAACAGGCTACGTGATTCCTTGCTTCCCAAGGATGA...

Protein

Download Protein FASTA

104 aa · TkA07G354640|TK1151|PROTEIN

MELRGLFQYLVNQLKKGSGIELFLLQELIQQMANVQYTENMTEEQLDAMAGSETLRYQATYFGATRNNKTLIKSTNRLRDSLLPKDEPKLAIPLLLLIAQHRAV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G354640`
TK1151 ID	TkA07G354640
OH-1004 ID	LXL04_022427
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.100
Protein coverage (%)	TK1151 100.000 / OH-1004 3.524 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G354640

Location Chr07:88742678-88743191 (+)

Description Similar to THO2: THO complex subunit 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g24706`	Acts as a component of the THO subcomplex of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022427 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0006406 mRNA export from nucleus Biological Process

GO:0008380 RNA splicing Biological Process

GO:0035196 miRNA processing Biological Process

GO:1990428 miRNA transport Biological Process

GO:0000347 THO complex Cellular Component

GO:0000445 THO complex part of transcription export complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0016607 nuclear speck Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G24706

cjc:100399788

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.357

Rank 1 · TkA07G354640 · TK1151

Nucleus0.355

Rank 2 · TkA07G354640 · TK1151

Mitochondrion0.250

Rank 3 · TkA07G354640 · TK1151

Cell membrane0.053

Rank 4 · TkA07G354640 · TK1151

Extracellular0.049

Rank 5 · TkA07G354640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30782DUF87356-103 aa

PF29026DUF4350_C10-48 aa

PF21933MCM5_C26-58 aa

PF21933MCM5_C74-86 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G354640	`PF30782`	DUF8735	6	103	0.2	11.5
TkA07G354640	`PF29026`	DUF4350_C	10	48	0.019	15.9
TkA07G354640	`PF21933`	MCM5_C	26	58	0.017	15.7
TkA07G354640	`PF21933`	MCM5_C	74	86	0.017	15.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IAT2`	Arabidopsis thaliana	sp\|F4IAT2\|THOC2_ARATH THO complex subunit 2	85.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card