TkA07G352140 | RubberDandelionOmics

Gene overview

TkA07G352140

Reference: TK1151 Chr: Chr07 Coordinates: 88010662-88012973 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1405 bp · TkA07G352140|TK1151|cDNA

AAAAATATGTGTAGTTCTCCAAACAATTTATTTGACCCGAGCTTTAGACTTAGTTTAGACGGGTTGGGTCAAATTGCTCCAAATTCTTTTAGCTTCTTCCCCCAAAACTCCTCCCCTAATCTCCAAACCAATTTTCTGCTCCTTTCTCATCTGAGCAGCTTATGGAGGTAGCGACTATGGCTTCCCATTTCTTTCCCAGCGCACGCACAGTTTCAAAAACCAATTCACGAAGTAATAGAACTGTAACCGCCGCTTCTTTA...

CDS

Download CDS FASTA

909 bp · TkA07G352140|TK1151|CDS

ATGGAGGTAGCGACTATGGCTTCCCATTTCTTTCCCAGCGCACGCACAGTTTCAAAAACCAATTCACGAAGTAATAGAACTGTAACCGCCGCTTCTTTATCACCATCTAATTCCTCTATTAAAGCATCCTTATCCACCAATTTCATCTCCCCGTACGTCAGCAGCAGTATTTGCAGCGACTTCTCCGGTCATAAGATCCGACCTGCGTCCCTCAACCCGTCCTCAAGCTCTCATGGAAAACGAGTTGGTGTTACTATGGT...

Protein

Download Protein FASTA

302 aa · TkA07G352140|TK1151|PROTEIN

MEVATMASHFFPSARTVSKTNSRSNRTVTAASLSPSNSSIKASLSTNFISPYVSSSICSDFSGHKIRPASLNPSSSSHGKRVGVTMVIPFSRGSAWEQPPPDLASYLYKNRIVYLGMSLVPSVTELILAEFLYLQYEDDKKPIYLYINSTGTTKGGEKLGYETEAFAIYDVMRYVKPPIFTLCVGNAWGEAALLLAAGAKGNRSALPSSTIMIKQPIARFQGQASDVEIMRREIKHVKTELVDLYAKHIGKTKEEIEEDI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G352140`
TK1151 ID	TkA07G352140
OH-1004 ID	LXL04_029836
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G352140

Location Chr07:88010662-88012973 (-)

Description Similar to CLPR4: ATP-dependent Clp protease proteolytic subunit-related protein 4, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g17040`	Involved in plastid protein homeostasis.	No verified direct reference in this release
`At1g09130`	ATP-dependent Clp protease proteolytic subunit-related protein 3, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029836 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000302 response to reactive oxygen species Biological Process

GO:0006515 protein quality control for misfolded or incompletely synthesized proteins Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009368 endopeptidase Clp complex Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009532 plastid stroma Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT1G09130

ath:AT4G17040

eba:ebA4970

syf:Synpcc7942_2538

syn:slr0164

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.958

Rank 1 · TkA07G352140 · TK1151

Mitochondrion0.041

Rank 2 · TkA07G352140 · TK1151

Nucleus0.025

Rank 3 · TkA07G352140 · TK1151

Cytoplasm0.013

Rank 4 · TkA07G352140 · TK1151

Cell membrane0.011

Rank 5 · TkA07G352140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00574CLP_protease102-283 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G352140	`PF00574`	CLP_protease	102	283	1.5e-53	182.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LB10`	Arabidopsis thaliana	sp\|Q8LB10\|CLPR4_ARATH ATP-dependent Clp protease proteolytic subunit-related protein 4, chloroplastic	80.700%	Swiss-Prot	High
`Q8L770`	Arabidopsis thaliana	sp\|Q8L770\|CLPR3_ARATH ATP-dependent Clp protease proteolytic subunit-related protein 3, chloroplastic	49.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card