TkA07G347850 | RubberDandelionOmics

Gene overview

TkA07G347850

Reference: TK1151 Chr: Chr07 Coordinates: 86934034-86934784 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

384 bp · TkA07G347850|TK1151|cDNA

ATGAAGATCGACGGTGGTGTGTCCGACGGGAATAGGAGGTGCGAAGACCTGGGGAGCTTCGGTGGGCAGTGGCTACCGGAGAAACTTAGCTTTCCGGTTGGTGGATTCCTCATATCCGGTGCTGCTAGGCCTAATTTCCAGGTGGTGGATGCTCTTGGAACAGATTATTTTGAACATCTACTTCCTGATATCATACAAAACTGTTCTCATCAAAGGTCACTTGTACGTGATGGTTATCTGACACTTTTCAAGTATCTGTC...

CDS

Download CDS FASTA

384 bp · TkA07G347850|TK1151|CDS

ATGAAGATCGACGGTGGTGTGTCCGACGGGAATAGGAGGTGCGAAGACCTGGGGAGCTTCGGTGGGCAGTGGCTACCGGAGAAACTTAGCTTTCCGGTTGGTGGATTCCTCATATCCGGTGCTGCTAGGCCTAATTTCCAGGTGGTGGATGCTCTTGGAACAGATTATTTTGAACATCTACTTCCTGATATCATACAAAACTGTTCTCATCAAAGGTCACTTGTACGTGATGGTTATCTGACACTTTTCAAGTATCTGTC...

Protein

Download Protein FASTA

127 aa · TkA07G347850|TK1151|PROTEIN

MKIDGGVSDGNRRCEDLGSFGGQWLPEKLSFPVGGFLISGAARPNFQVVDALGTDYFEHLLPDIIQNCSHQRSLVRDGYLTLFKYLSRSLGVKFQNYLQQVLPAILDGKTSATSRASTTAFPLHVSI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G347850`
TK1151 ID	TkA07G347850
OH-1004 ID	LXL04_029795
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 79.874 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G347850

Location Chr07:86934034-86934784 (-)

Description Similar to ILA: Protein ILITYHIA

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g64790`	Involved in immunity against bacterial infection and in non-host resistance.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029795 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006414 translational elongation Biological Process

GO:0006417 regulation of translation Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0009682 induced systemic resistance Biological Process

GO:0031571 mitotic G1 DNA damage checkpoint signaling Biological Process

GO:0034198 cellular response to amino acid starvation Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045087 innate immune response Biological Process

GO:0072344 rescue of stalled cytosolic ribosome Biological Process

GO:0085020 protein K6-linked ubiquitination Biological Process

GO:0140469 GCN2-mediated signaling Biological Process

KEGG gene cross-reference

ath:AT1G64790

hsa:10985

mmu:231659

spo:2542235

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.510

Rank 1 · TkA07G347850 · TK1151

Nucleus0.427

Rank 2 · TkA07G347850 · TK1151

Mitochondrion0.096

Rank 3 · TkA07G347850 · TK1151

Endoplasmic reticulum0.082

Rank 4 · TkA07G347850 · TK1151

Cell membrane0.067

Rank 5 · TkA07G347850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24714TOR1L1_N48-105 aa

PF28359CandA_N71-107 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G347850	`PF24714`	TOR1L1_N	48	105	0.12	12.4
TkA07G347850	`PF28359`	CandA_N	71	107	0.062	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I893`	Arabidopsis thaliana	sp\|F4I893\|ILA_ARATH Protein ILITYHIA	61.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card