RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G347660
Reference: TK1151 Chr: Chr07 Coordinates: 86886517-86888262 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1288 bp · TkA07G347660|TK1151|cDNA

CCCTCTCTTTCTATATAATCCCATTCATCACCCTCCCTCTGAATTATTGTCAAACGCTTTTCAATCTCCATATCCCAGATTCAAAGAGAGTGATTAGAGCTGTCTTTTTTATCGTCAAGTTTCAGTTGAATATACATACATAAACCCAGAAGAAGAAAGATAAATTTCTACTGTGAAATGATGGTTGAGAAGGAAGATTTGGGTTTGAGTCTTGGCTTGAACTTTCCGGCGACCTCGGAGAGGAATCCGTCGTCACTTCA...

CDS

Download CDS FASTA

906 bp · TkA07G347660|TK1151|CDS

ATGATGGTTGAGAAGGAAGATTTGGGTTTGAGTCTTGGCTTGAACTTTCCGGCGACCTCGGAGAGGAATCCGTCGTCACTTCAGTTGAATCTGATGCCTTCTTTTGTTTCGTCGTCTCCGTCGTTCAATCTTCTTCATAGAACGCCTAACTGGTCCGATCCGTGCCCGTCTTCATCAGATCGGAACATCGCCGATGCATTTAAAGTGGAGACTAGGTCGTTCCTGAAAGGGATCGATGTGAACAGAATACCGCCGACAGC...

Protein

Download Protein FASTA

301 aa · TkA07G347660|TK1151|PROTEIN

MMVEKEDLGLSLGLNFPATSERNPSSLQLNLMPSFVSSSPSFNLLHRTPNWSDPCPSSSDRNIADAFKVETRSFLKGIDVNRIPPTAAEVEEEAGVSSPNSTISSISGKRSERDLPVNEQDGERASSRGMSDDEDGDNSRKKLRLSKDQSAVLEESFKEHNTLNPKQKLALAKRLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCENLTEENRRLQKELQELRALKLSPQFYMQMAPPTTLTMCPSCERVAAPPSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G347660
TK1151 IDTkA07G347660
OH-1004 IDLXL04_029794
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G347660
LocationChr07:86886517-86888262 (+)
DescriptionSimilar to HAT4: Homeobox-leucine zipper protein HAT4
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g16780 Probable transcription factor involved in the negative regulation of cell elongation and specific cell proliferation processes such as lateral root formation and secondary growth of the vascular system.
Negative autoregulation of the Arabidopsis homeobox gene ATHB-2.2001 · DOI: 10.1046/j.1365-313x.2001.00966.x
The HAT4 gene of Arabidopsis encodes a developmental regulator.1993 · DOI: 10.1101/gad.7.3.367
At4g17460 Probable transcription factor. No verified direct reference in this release
At5g47370 Probable transcription factor that plays a role in auxin-mediated morphogenesis.
The HAT2 gene, a member of the HD-Zip gene family, isolated as an auxin inducible gene by DNA microarray screening, affects auxin response in Arabidopsis.2002 · DOI: 10.1046/j.1365-313x.2002.01488.x
At3g60390 Probable transcription factor. No verified direct reference in this release
At2g44910 Probable transcription factor. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_029794 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0003006 developmental process involved in reproduction Biological Process
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0009585 red, far-red light phototransduction Biological Process
GO:0009641 shade avoidance Biological Process
GO:0009725 response to hormone Biological Process
GO:0009733 response to auxin Biological Process
GO:0009734 auxin-activated signaling pathway Biological Process
GO:0009735 response to cytokinin Biological Process
GO:0009826 unidimensional cell growth Biological Process
GO:0010016 shoot system morphogenesis Biological Process
GO:0010017 red or far-red light signaling pathway Biological Process
KEGG gene cross-reference
ath:AT2G44910
ath:AT3G60390
ath:AT4G16780
ath:AT4G17460
ath:AT5G47370
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.982
Rank 1 · TkA07G347660 · TK1151
Cytoplasm0.072
Rank 2 · TkA07G347660 · TK1151
Cell membrane0.022
Rank 3 · TkA07G347660 · TK1151
Endoplasmic reticulum0.014
Rank 4 · TkA07G347660 · TK1151
Plastid0.010
Rank 5 · TkA07G347660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04618HD-ZIP_N2-114 aa
PF05920Homeobox_KN50-61 aa
PF08961NRBF2124-229 aa
PF00046Homeodomain140-194 aa
PF24627PUMA_CC140-159 aa
PF27636CCPG1_N147-225 aa
PF05920Homeobox_KN165-192 aa
PF24627PUMA_CC191-227 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G347660PF04618HD-ZIP_N21142.7e-31109.0
TkA07G347660PF05920Homeobox_KN50610.000520.6
TkA07G347660PF08961NRBF21242290.311.3
TkA07G347660PF00046Homeodomain1401943.2e-1659.6
TkA07G347660PF24627PUMA_CC1401590.03714.8
TkA07G347660PF27636CCPG1_N1472250.6111.4
TkA07G347660PF05920Homeobox_KN1651920.000520.6
TkA07G347660PF24627PUMA_CC1912270.03714.8
TkA07G347660PF06156YabA1922300.04315.1
TkA07G347660PF02183HALZ1962305.6e-1143.1
TkA07G347660PF04618HD-ZIP_N2622692.7e-31109.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q05466Arabidopsis thalianasp|Q05466|HAT4_ARATH Homeobox-leucine zipper protein HAT461.000%Swiss-ProtHigh
P46600Arabidopsis thalianasp|P46600|HAT1_ARATH Homeobox-leucine zipper protein HAT155.600%Swiss-ProtHigh
P46601Arabidopsis thalianasp|P46601|HAT2_ARATH Homeobox-leucine zipper protein HAT255.600%Swiss-ProtHigh
P46602Arabidopsis thalianasp|P46602|HAT3_ARATH Homeobox-leucine zipper protein HAT356.000%Swiss-ProtHigh
P92953Arabidopsis thalianasp|P92953|ATHB4_ARATH Homeobox-leucine zipper protein ATHB-460.800%Swiss-ProtHigh

JBrowse

View in Genome Browser