TkA07G346060 | RubberDandelionOmics

Gene overview

TkA07G346060

Reference: TK1151 Chr: Chr07 Coordinates: 86505093-86508545 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1557 bp · TkA07G346060|TK1151|cDNA

CCACAATCTTCTTTATGATTTATAGATTAAATGCAATAGTTTATGCATTCACCAGTACACCTAGAATCTTCGTCCTGATCCTAAAGCATTATTCCTTCTGTGTATAAATTCATCAATGCATTCAACAATAACGACGTGAAATCAAAGCTCACAAATAGAAAACAATTCGCAATCACCACGAAACCGAATTTGGTTTTGCGGTGAGGTTGAAAAAAAATAGGGGAGAAATGGGAGAGAAAATGGTGAAGTATGGAATCATC...

CDS

Download CDS FASTA

1104 bp · TkA07G346060|TK1151|CDS

ATGGGAGAGAAAATGGTGAAGTATGGAATCATCGGTGCCGGAATGATGGGGAGAGAGCATTTCTGTAATCTGTACCATCTCCGGAGCGAAGGTGTCGCCGTCGTTTGTGTCGCCGATCCCAACCTCTCTTCTCAACAGATTTCGACGGAATTTGCCGAGTCCTTTGGCTGGCCACTCAAGGTTTTTTCAGGACATCAAGAACTGCTAGACAGTGGGATGTGTGATGTTGTAGTTGTTTCAACTCCAAATATGACTCATTT...

Protein

Download Protein FASTA

367 aa · TkA07G346060|TK1151|PROTEIN

MGEKMVKYGIIGAGMMGREHFCNLYHLRSEGVAVVCVADPNLSSQQISTEFAESFGWPLKVFSGHQELLDSGMCDVVVVSTPNMTHFEILMDIISHPKTHHVLVEKPLCTTVQDCRQVIEAAKKRPDMLVQVGLEYRYMPPVAKLMDIVNGGRLGNIRMVSIREHRFPFLVKVDNWNRFNCNSGGTMVEKCCHFFDLMRLFVGANPVRVMASGAIDVNHKDEVYDGKVPDIIDNAYVIVEFDNGARGMLDLCMFAEGSKN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G346060`
TK1151 ID	TkA07G346060
OH-1004 ID	LXL04_029772
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G346060`
Location	Chr07:86505093-86508545 (+)
Description	Similar to iolG: Myo-inositol 2-dehydrogenase (Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_029772` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006020 inositol metabolic process Biological Process GO:0006740 NADPH regeneration Biological Process GO:0019310 inositol catabolic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0000166 nucleotide binding Molecular Function GO:0016491 oxidoreductase activity Molecular Function GO:0050112 inositol 2-dehydrogenase (NAD+) activity Molecular Function
KEGG gene cross-reference	bsu:BSU27770 spn:SP_1686 stm:STM4425 tma:TM0414 tmi:THEMA_02655 tmm:Tmari_0411 tmw:THMA_0420 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.699

Rank 1 · TkA07G346060 · TK1151

Nucleus0.412

Rank 2 · TkA07G346060 · TK1151

Cell membrane0.081

Rank 3 · TkA07G346060 · TK1151

Mitochondrion0.072

Rank 4 · TkA07G346060 · TK1151

Endoplasmic reticulum0.050

Rank 5 · TkA07G346060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01408GFO_IDH_MocA7-133 aa

PF03807F420_oxidored7-104 aa

PF01488Shikimate_DH7-82 aa

PF08635ox_reductase_C137-219 aa

PF22725GFO_IDH_MocA_C3143-271 aa

PF02894GFO_IDH_MocA_C149-361 aa

PF21744BAHCC1-like_Tudor231-251 aa

PF21744BAHCC1-like_Tudor326-340 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G346060	`PF01408`	GFO_IDH_MocA	7	133	5.5e-28	98.8
TkA07G346060	`PF03807`	F420_oxidored	7	104	0.12	13.7
TkA07G346060	`PF01488`	Shikimate_DH	7	82	0.17	12.7
TkA07G346060	`PF08635`	ox_reductase_C	137	219	0.0052	17.2
TkA07G346060	`PF22725`	GFO_IDH_MocA_C3	143	271	4.9e-17	62.8
TkA07G346060	`PF02894`	GFO_IDH_MocA_C	149	361	2.2e-38	133.0
TkA07G346060	`PF21744`	BAHCC1-like_Tudor	231	251	0.18	12.5
TkA07G346060	`PF21744`	BAHCC1-like_Tudor	326	340	0.18	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card