TkA07G345890 | RubberDandelionOmics

Gene overview

TkA07G345890

Reference: TK1151 Chr: Chr07 Coordinates: 86451545-86456767 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4418 bp · TkA07G345890|TK1151|cDNA

CCAAAAGTTCCGTACAAAAGTTTAAATTAAAATACCAAACAACCAAAGCACCACAAAACACTTATTTTAGGGAATACCTAGCAGCAAACAATAAAGAGAAGCAGAATAATTACAGCACCAACATGAGACTTGTAGTAGCAACCTGAGGACAACACCAACATGAGACTTGAATCATCAAGGGAGGACACCAAACAACAACACCAAATGTTACGCCAAACTGCATGTCCAAGGCGTGAGAGAGAGACAGGGGCAGATTGGTC...

CDS

Download CDS FASTA

675 bp · TkA07G345890|TK1151|CDS

ATGGATCCTTTCGAGAGTACTAATTGGGATCTAATCGATTACGACAATCTCATCAACGATGTCGCATCCACTGATCTTTATTGGGGTGACCAGAGTACTGCAATCCCGGTTGATGCTTCACTTGCTAGCTTTGCACCACTAGAAGAATGTGCTGAGAAAGAATGCACACGAAAGAGGGGAAGAAGTAATTCGTGCAGCAGGGCAGAGAATAAAGCATGCCGTGAGAGGCAAAGGAGGGAGAAATTGAATGACAGGTTTTT...

Protein

Download Protein FASTA

224 aa · TkA07G345890|TK1151|PROTEIN

MDPFESTNWDLIDYDNLINDVASTDLYWGDQSTAIPVDASLASFAPLEECAEKECTRKRGRSNSCSRAENKACRERQRREKLNDRFLELSSTLEPGRPAITDKLAILGDAIRVLNQLKSESQDCKEMNEKLLEEIKTLKDKFVTKQAEKNELREEKLVLKAEKAKVEQQVKALTNHHPPHGFMTPHAANKMPVFPGYGYIPMWQYLPQSAQDTSHDHELRPPAA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G345890`
TK1151 ID	TkA07G345890
OH-1004 ID	LXL04_029768
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	90.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G345890

Location Chr07:86451545-86456767 (+)

Description Similar to BHLH104: Transcription factor bHLH104

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g14410`	Transcription factor bHLH104.	No verified direct reference in this release
`At3g23210`	Transcription factor bHLH34.	No verified direct reference in this release
`At5g54680`	Transcription factor.	An Arabidopsis basic helix-loop-helix leucine zipper protein modulates metal homeostasis and auxin conjugate responsiveness.2006 · DOI: 10.1534/genetics.106.061044
`At1g51070`	Transcription factor bHLH115.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029768 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006879 intracellular iron ion homeostasis Biological Process

GO:0010030 positive regulation of seed germination Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0060586 multicellular organismal-level iron ion homeostasis Biological Process

GO:0071333 cellular response to glucose stimulus Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G51070

ath:AT3G19860

ath:AT3G23210

ath:AT4G14410

ath:AT5G54680

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.958

Rank 1 · TkA07G345890 · TK1151

Cytoplasm0.146

Rank 2 · TkA07G345890 · TK1151

Cell membrane0.023

Rank 3 · TkA07G345890 · TK1151

Endoplasmic reticulum0.014

Rank 4 · TkA07G345890 · TK1151

Mitochondrion0.009

Rank 5 · TkA07G345890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06428Sec2p64-83 aa

PF23177bHLH_IRO367-163 aa

PF00010HLH68-118 aa

PF30677CCDC18_1st74-94 aa

PF29997SPC25_N77-77 aa

PF13456RVT_3103-144 aa

PF28175T4SS_LegC2C7109-175 aa

PF30677CCDC18_1st110-176 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G345890	`PF06428`	Sec2p	64	83	4.8	8.1
TkA07G345890	`PF23177`	bHLH_IRO3	67	163	3.8e-34	117.6
TkA07G345890	`PF00010`	HLH	68	118	1.3e-08	35.3
TkA07G345890	`PF30677`	CCDC18_1st	74	94	1.7	8.5
TkA07G345890	`PF29997`	SPC25_N	77	77	3.8	8.6
TkA07G345890	`PF13456`	RVT_3	103	144	0.02	15.5
TkA07G345890	`PF28175`	T4SS_LegC2C7	109	175	0.0052	16.4
TkA07G345890	`PF30677`	CCDC18_1st	110	176	1.7	8.5
TkA07G345890	`PF29308`	YEL043W_helical	112	175	0.21	12.4
TkA07G345890	`PF06428`	Sec2p	113	175	4.8	8.1
TkA07G345890	`PF29997`	SPC25_N	114	175	3.8	8.6
TkA07G345890	`PF00484`	Pro_CA	118	176	0.23	12.4
TkA07G345890	`PF19717`	DUF6212	120	208	0.12	12.0
TkA07G345890	`PF28325`	Beta_trefoil_fun	126	188	0.058	13.9
TkA07G345890	`PF13456`	RVT_3	155	189	0.02	15.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L467`	Arabidopsis thaliana	sp\|Q8L467\|BH104_ARATH Transcription factor bHLH104	53.000%	Swiss-Prot	High
`Q9LTC7`	Arabidopsis thaliana	sp\|Q9LTC7\|BH034_ARATH Transcription factor bHLH34	46.900%	Swiss-Prot	Medium
`Q9FH37`	Arabidopsis thaliana	sp\|Q9FH37\|ILR3_ARATH Transcription factor ILR3	35.000%	Swiss-Prot	Medium
`Q9C682`	Arabidopsis thaliana	sp\|Q9C682\|BH115_ARATH Transcription factor bHLH115	31.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card