TkA07G343830 | RubberDandelionOmics

Gene overview

TkA07G343830

Reference: TK1151 Chr: Chr07 Coordinates: 85857523-85867389 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1943 bp · TkA07G343830|TK1151|cDNA

TTAAATTCCATTTGATAAATACTAAGTATATTTTTGGTTGAATTGCACAAGAAGAATAGAAGGGTTTCAAATCTCATCACGAATCCAGATTCTTGAAAAACACGAAGGATTTATCTCTTGGAGCAACACGTATTCAACCAAAGGGAGAAAGGTTTCTGATATTTATTCCAATCCAATTCATCAAAACCAGACAAAGTCGATACATAAAAAGGTTTCTTGACTTCATTCATATTCCCACCATAATTTAATCTTCTAATTCA...

CDS

Download CDS FASTA

1074 bp · TkA07G343830|TK1151|CDS

ATGAGCAGGCCAGAATTCATCGAAGATGTGAGAATAATCGGTGGATTGATCGGAGTCCAGTTTATATACGCAGGAAACTCAGTTTTGCAGAAGTATCTCATGTCTGAAGGCCTTCCTCAGTCTCCATTTATCATCTCCCTCAATTTCATCACCTTTCTTCTCCTCTCCCCTCTTGCACTTTTCTTCGAAAGGAAAGCTTGGCCGAAGAGATTGAGCATCAAATTATCGGTTCATTTGGTTTTAATAGCATTTGCAGGGGT...

Protein

Download Protein FASTA

357 aa · TkA07G343830|TK1151|PROTEIN

MSRPEFIEDVRIIGGLIGVQFIYAGNSVLQKYLMSEGLPQSPFIISLNFITFLLLSPLALFFERKAWPKRLSIKLSVHLVLIAFAGVTLFQSLTLKGINLTSASMATAMPNLAPGLVFLIALAFRLEKVDIGCTYSRVKIVGTFLCVVGAITMTIMQSTKKKSITNDIFPHDSSSPPTEHFYIFDKNRIIGCLYLIAAVIVLSSNVILQAITLRDMPAPISLCAITSLIGVMLTVMVEFIQDHAIGKEWHVWSLKQLTWY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G343830`
TK1151 ID	TkA07G343830
OH-1004 ID	LXL04_029753
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G343830

Location Chr07:85857523-85867389 (-)

Description Similar to At5g47470: WAT1-related protein At5g47470

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47470`	WAT1-related protein At5g47470.	No verified direct reference in this release
`At4g16620`	WAT1-related protein At4g16620.	No verified direct reference in this release
`At3g30340`	WAT1-related protein At3g30340.	No verified direct reference in this release
`At1g09380`	WAT1-related protein At1g09380.	No verified direct reference in this release
`At4g28040`	WAT1-related protein At4g28040.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029753 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009620 response to fungus Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT2G37460

ath:AT4G08290

ath:AT4G16620

ath:AT4G30420

ath:AT5G47470

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.351

Rank 1 · TkA07G343830 · TK1151

Cell membrane0.323

Rank 2 · TkA07G343830 · TK1151

Endoplasmic reticulum0.158

Rank 3 · TkA07G343830 · TK1151

Golgi apparatus0.096

Rank 4 · TkA07G343830 · TK1151

Cytoplasm0.086

Rank 5 · TkA07G343830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24417DUF75498-28 aa

PF04657DMT_YdcZ12-31 aa

PF00892EamA16-153 aa

PF27705UCP01005642-90 aa

PF04657DMT_YdcZ105-127 aa

PF24417DUF7549115-153 aa

PF27705UCP010056138-244 aa

PF24417DUF7549185-235 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G343830	`PF24417`	DUF7549	8	28	8.7	6.9
TkA07G343830	`PF04657`	DMT_YdcZ	12	31	0.025	15.6
TkA07G343830	`PF00892`	EamA	16	153	3e-16	60.7
TkA07G343830	`PF27705`	UCP010056	42	90	2.7	8.0
TkA07G343830	`PF04657`	DMT_YdcZ	105	127	0.025	15.6
TkA07G343830	`PF24417`	DUF7549	115	153	8.7	6.9
TkA07G343830	`PF27705`	UCP010056	138	244	2.7	8.0
TkA07G343830	`PF24417`	DUF7549	185	235	8.7	6.9
TkA07G343830	`PF00892`	EamA	190	328	3e-16	60.7
TkA07G343830	`PF04657`	DMT_YdcZ	224	325	0.025	15.6
TkA07G343830	`PF24417`	DUF7549	276	303	8.7	6.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGL0`	Arabidopsis thaliana	sp\|Q9FGL0\|WTR44_ARATH WAT1-related protein At5g47470	53.800%	Swiss-Prot	High
`F4JMI7`	Arabidopsis thaliana	sp\|F4JMI7\|WTR34_ARATH WAT1-related protein At4g16620	46.400%	Swiss-Prot	Medium
`Q9LI65`	Arabidopsis thaliana	sp\|Q9LI65\|WTR24_ARATH WAT1-related protein At3g30340	28.500%	Swiss-Prot	Low
`Q8GXB4`	Arabidopsis thaliana	sp\|Q8GXB4\|WTR2_ARATH WAT1-related protein At1g09380	28.700%	Swiss-Prot	Low
`Q9SUD5`	Arabidopsis thaliana	sp\|Q9SUD5\|WTR36_ARATH WAT1-related protein At4g28040	26.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card