TkA07G342980 | RubberDandelionOmics

Gene overview

TkA07G342980

Reference: TK1151 Chr: Chr07 Coordinates: 85631847-85635882 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2251 bp · TkA07G342980|TK1151|cDNA

CTTTGGACCCAGGCAGCAAACGATGAACAATTGAACACACGGTTACAACATCACAAGGCCAGCAAAGAAAACCCTCAAAAACCCCCGAAACAAGAAAACACATAAACCCCGCACAGTTTCCAATCAAAAAAGCAAATCAGAATAACCCTCACTATTCATCTGATGCTTCAAGCAATCTTTACTAGATAAAGACACTATTCTTTCGATTATCTGCTCGATAGAACCCTAAAAAGGGAAATTAGACCCAATTTGAAGTTATG...

CDS

Download CDS FASTA

408 bp · TkA07G342980|TK1151|CDS

ATGCTCTACTTACATGTATCTCCGGAAGCTTCAGATGAAGAAATCCGTAAAGCTTATCGTCTATGGGCTCAAGTCTATCACCCTGATAAATACCAATCTGCACAGGAAAAGGAAGTGGCAAACAGTGAACTTTCAGAAATATGTGAAGCATACGAGATATTATCAGACGAAAACAAAAGACAAATATACGATATATACGGGATGGAAGGGCTAACCTCCGGTCTAGAACTGGGTCCAAAATTAAACAAAGTGGAAGAAAT...

Protein

Download Protein FASTA

135 aa · TkA07G342980|TK1151|PROTEIN

MLYLHVSPEASDEEIRKAYRLWAQVYHPDKYQSAQEKEVANSELSEICEAYEILSDENKRQIYDIYGMEGLTSGLELGPKLNKVEEIKEELERLKRKREEEKASAHFQPSGVILAQLSLQVFIRSRFNESNVDEQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G342980`
TK1151 ID	TkA07G342980
OH-1004 ID	LXL04_029746
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	91.700
Protein coverage (%)	TK1151 88.889 / OH-1004 22.222 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G342980

Location Chr07:85631847-85635882 (-)

Description Similar to ATJ13: Chaperone protein dnaJ 13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g35720`	Plays a continuous role in plant development probably in the structural organization of compartments (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029746 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007007 inner mitochondrial membrane organization Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0042407 cristae formation Biological Process

GO:0055122 response to very low light intensity stimulus Biological Process

GO:0001401 SAM complex Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ath:AT2G35720

bta:508137

hsa:55735

mmu:230935

pon:100172247

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.503

Rank 1 · TkA07G342980 · TK1151

Nucleus0.307

Rank 2 · TkA07G342980 · TK1151

Endoplasmic reticulum0.119

Rank 3 · TkA07G342980 · TK1151

Mitochondrion0.105

Rank 4 · TkA07G342980 · TK1151

Golgi apparatus0.078

Rank 5 · TkA07G342980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00226DnaJ4-64 aa

PF30945NFKBIL1_C4-56 aa

PF08587UBA_210-21 aa

PF10046BLOC1_237-96 aa

PF08587UBA_241-55 aa

PF30945NFKBIL1_C81-97 aa

PF00226DnaJ84-95 aa

PF08587UBA_285-95 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G342980	`PF00226`	DnaJ	4	64	1.3e-18	67.5
TkA07G342980	`PF30945`	NFKBIL1_C	4	56	0.02	15.5
TkA07G342980	`PF08587`	UBA_2	10	21	1.1	10.0
TkA07G342980	`PF10046`	BLOC1_2	37	96	0.0087	17.1
TkA07G342980	`PF08587`	UBA_2	41	55	1.1	10.0
TkA07G342980	`PF30945`	NFKBIL1_C	81	97	0.02	15.5
TkA07G342980	`PF00226`	DnaJ	84	95	1.3e-18	67.5
TkA07G342980	`PF08587`	UBA_2	85	95	1.1	10.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39079`	Arabidopsis thaliana	sp\|Q39079\|DNJ13_ARATH Chaperone protein dnaJ 13	71.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card