TkA07G334970 | RubberDandelionOmics

Gene overview

TkA07G334970

Reference: TK1151 Chr: Chr07 Coordinates: 83684091-83685713 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1011 bp · TkA07G334970|TK1151|cDNA

ATGAATCTTGACTATCAAAAAGATGAGTCACTATTAAGTTTAGTGAATGAAATCAAGGATCTTGAGATACAAGTTGAAGAAAGGAAGAAGTGGGCTGAAGAAAAGGCAGTTCAAGTGGCAAAAAGGCTGTGTGATGATCGCAATAAGTTAAAGAAGTTAAAAATGTTAAGAGAAGATAATGAACAAATGAGGAAGCAGGAGAAGTCAATTCTTGACATTGACCACCCCACCATGAAGAGTCTTATAGATGTTGAGATGAC...

CDS

Download CDS FASTA

1011 bp · TkA07G334970|TK1151|CDS

ATGAATCTTGACTATCAAAAAGATGAGTCACTATTAAGTTTAGTGAATGAAATCAAGGATCTTGAGATACAAGTTGAAGAAAGGAAGAAGTGGGCTGAAGAAAAGGCAGTTCAAGTGGCAAAAAGGCTGTGTGATGATCGCAATAAGTTAAAGAAGTTAAAAATGTTAAGAGAAGATAATGAACAAATGAGGAAGCAGGAGAAGTCAATTCTTGACATTGACCACCCCACCATGAAGAGTCTTATAGATGTTGAGATGAC...

Protein

Download Protein FASTA

336 aa · TkA07G334970|TK1151|PROTEIN

MNLDYQKDESLLSLVNEIKDLEIQVEERKKWAEEKAVQVAKRLCDDRNKLKKLKMLREDNEQMRKQEKSILDIDHPTMKSLIDVEMTLRQKSAQVDRARVVVSCLELENMEMKAETEAAKLSASESMTQRLEAAKREKKHLKKISAWEKQRCKMQEEIALEKQKLLDLEYEMLQVEAANKAAEAKWREKQESKKHALARVKQERHLKKQTESNVKRTHESLRAKIDLDFKCHKDDMQRLEQELSRAKSLTDPDNDLTIGK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G334970`
TK1151 ID	TkA07G334970
OH-1004 ID	LXL04_029664
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.900
Protein coverage (%)	TK1151 100.000 / OH-1004 54.383 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G334970

Location Chr07:83684091-83685713 (+)

Description Similar to MIP1: MND1-interacting protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g32530`	MND1-interacting protein 1.	No verified direct reference in this release
`At1g03365`	Putative E3 ubiquitin-protein ligase RF4.	No verified direct reference in this release
`At4g03000`	Putative E3 ubiquitin-protein ligase RF298.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029664 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

KEGG gene cross-reference

ath:AT1G03365

ath:AT1G32530

ath:AT4G03000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.472

Rank 1 · TkA07G334970 · TK1151

Nucleus0.461

Rank 2 · TkA07G334970 · TK1151

Cell membrane0.101

Rank 3 · TkA07G334970 · TK1151

Endoplasmic reticulum0.037

Rank 4 · TkA07G334970 · TK1151

Lysosome / Vacuole0.030

Rank 5 · TkA07G334970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06906DUF1272278-291 aa

PF13920zf-C3HC4_3282-327 aa

PF13639zf-RING_2284-321 aa

PF12773DZR284-291 aa

PF14447Prok-RING_4285-328 aa

PF14634zf-RING_5286-322 aa

PF06906DUF1272299-328 aa

PF12773DZR302-327 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G334970	`PF06906`	DUF1272	278	291	2.7	8.9
TkA07G334970	`PF13920`	zf-C3HC4_3	282	327	1.2e-12	48.1
TkA07G334970	`PF13639`	zf-RING_2	284	321	0.028	15.4
TkA07G334970	`PF12773`	DZR	284	291	0.26	12.2
TkA07G334970	`PF14447`	Prok-RING_4	285	328	2.8e-05	24.6
TkA07G334970	`PF14634`	zf-RING_5	286	322	0.81	10.4
TkA07G334970	`PF06906`	DUF1272	299	328	2.7	8.9
TkA07G334970	`PF12773`	DZR	302	327	0.26	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RX22`	Arabidopsis thaliana	sp\|Q8RX22\|MIP1_ARATH MND1-interacting protein 1	39.800%	Swiss-Prot	Medium
`Q9ZVT8`	Arabidopsis thaliana	sp\|Q9ZVT8\|RF4_ARATH Putative E3 ubiquitin-protein ligase RF4	33.000%	Swiss-Prot	Medium
`Q0WPJ7`	Arabidopsis thaliana	sp\|Q0WPJ7\|RF298_ARATH Putative E3 ubiquitin-protein ligase RF298	27.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card