TkA07G334530 | RubberDandelionOmics

Gene overview

TkA07G334530

Reference: TK1151 Chr: Chr07 Coordinates: 83585672-83588941 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1204 bp · TkA07G334530|TK1151|cDNA

CTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCACCTTCACTCTCACCAGTCACCACCTCATAATGGGTTCTCAATCTAACGGTTCACCTGCGACGCCATTTAAGTTCTTGATCTACGGGCGCACGGGTTGGATTGGTGGTCTATTGGGCAAACTCTGCGAAGCTCAGGGCATCGAGTACACCTACGGCTCCGGCCGCCTCGAGTCTCGTGACACCCTCATCGCTGACCTCGCTGCCGTCAATCCTACCCAT...

CDS

Download CDS FASTA

906 bp · TkA07G334530|TK1151|CDS

ATGGGTTCTCAATCTAACGGTTCACCTGCGACGCCATTTAAGTTCTTGATCTACGGGCGCACGGGTTGGATTGGTGGTCTATTGGGCAAACTCTGCGAAGCTCAGGGCATCGAGTACACCTACGGCTCCGGCCGCCTCGAGTCTCGTGACACCCTCATCGCTGACCTCGCTGCCGTCAATCCTACCCATGTATTCAACGCTGCGGGAATCACCGGACGCCCAAACGTTGACTGGTGTGAGTCACACAAGGTGGAGACGAT...

Protein

Download Protein FASTA

301 aa · TkA07G334530|TK1151|PROTEIN

MGSQSNGSPATPFKFLIYGRTGWIGGLLGKLCEAQGIEYTYGSGRLESRDTLIADLAAVNPTHVFNAAGITGRPNVDWCESHKVETIRTNVVGTLTLADVCREKGLILINYATGCIFEYDSVHQLGSGVGFKEEDTPNFVGSFYSKTKAMVEELLKNYENVCTLRVRMPISSDLSNPRNFITKISRYEKVVDIPNSMTILDELLPISIEMAKRNLTGIYNFTNPGCVSHNEVLELYKEYIDSSFTWKNFTLEEQAKVIIA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G334530`
TK1151 ID	TkA07G334530
OH-1004 ID	LXL04_037797
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	81.700
Protein coverage (%)	TK1151 94.352 / OH-1004 39.832 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G334530

Location Chr07:83585672-83588941 (-)

Description Similar to RHM1: Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g63000`	Bifunctional enzyme involved in dTDP-beta-L-rhamnose biosynthesis.	No verified direct reference in this release
`At1g78570`	Trifunctional enzyme involved in UDP-beta-L-rhamnose biosynthesis, a precursor of the primary cell wall components rhamnogalacturonan I (RG-I) and rhamnogalacturonan II (RG-II).	Functional analysis of Arabidopsis thaliana RHM2/MUM4, a multidomain protein involved in UDP-D-glucose to UDP-L-rhamnose conversion.2007 · DOI: 10.1074/jbc.m610196200 Comprehensive flavonol profiling and transcriptome coexpression analysis leading to decoding gene-metabolite correlations in Arabidopsis.2008 · DOI: 10.1105/tpc.108.058040 Overexpression of a cytosol-localized rhamnose biosynthesis protein encoded by Arabidopsis RHM1 gene increases rhamnose content in cell wall.2009 · DOI: 10.1016/j.plaphy.2008.10.011
`At3g14790`	Trifunctional enzyme involved in UDP-beta-L-rhamnose biosynthesis, a precursor of the primary cell wall components rhamnogalacturonan I (RG-I) and rhamnogalacturonan II (RG-II).	Functional analysis of Arabidopsis thaliana RHM2/MUM4, a multidomain protein involved in UDP-D-glucose to UDP-L-rhamnose conversion.2007 · DOI: 10.1074/jbc.m610196200
`At1g53500`	Trifunctional enzyme involved in UDP-beta-L-rhamnose biosynthesis, a precursor of the primary cell wall components rhamnogalacturonan I (RG-I) and rhamnogalacturonan II (RG-II).	RHM2 is involved in mucilage pectin synthesis and is required for the development of the seed coat in Arabidopsis.2004 · DOI: 10.1104/pp.103.034314 Functional analysis of Arabidopsis thaliana RHM2/MUM4, a multidomain protein involved in UDP-D-glucose to UDP-L-rhamnose conversion.2007 · DOI: 10.1074/jbc.m610196200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037797 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006556 S-adenosylmethionine biosynthetic process Biological Process

GO:0010192 mucilage biosynthetic process Biological Process

GO:0010214 seed coat development Biological Process

GO:0010253 UDP-rhamnose biosynthetic process Biological Process

GO:0010315 auxin export across the plasma membrane Biological Process

GO:0019300 rhamnose biosynthetic process Biological Process

GO:0019305 dTDP-rhamnose biosynthetic process Biological Process

GO:0030154 cell differentiation Biological Process

GO:0042127 regulation of cell population proliferation Biological Process

GO:0051555 flavonol biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G53500

ath:AT1G63000

ath:AT1G78570

ath:AT3G14790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.701

Rank 1 · TkA07G334530 · TK1151

Nucleus0.327

Rank 2 · TkA07G334530 · TK1151

Mitochondrion0.091

Rank 3 · TkA07G334530 · TK1151

Cell membrane0.063

Rank 4 · TkA07G334530 · TK1151

Peroxisome0.059

Rank 5 · TkA07G334530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04321RmlD_sub_bind14-186 aa

PF01370Epimerase16-178 aa

PF16363GDP_Man_Dehyd41-182 aa

PF02719Polysacc_synt_248-105 aa

PF07993NAD_binding_476-166 aa

PF010733Beta_HSD84-157 aa

PF14286DHHW130-190 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G334530	`PF04321`	RmlD_sub_bind	14	186	1.9e-13	50.9
TkA07G334530	`PF01370`	Epimerase	16	178	6.5e-12	46.1
TkA07G334530	`PF16363`	GDP_Man_Dehyd	41	182	1.1e-05	25.8
TkA07G334530	`PF02719`	Polysacc_synt_2	48	105	0.0011	19.0
TkA07G334530	`PF07993`	NAD_binding_4	76	166	0.046	13.6
TkA07G334530	`PF01073`	3Beta_HSD	84	157	0.24	11.1
TkA07G334530	`PF14286`	DHHW	130	190	0.12	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LQ04`	Arabidopsis thaliana	sp\|Q9LQ04\|RMLCD_ARATH Bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose reductase	84.100%	Swiss-Prot	High
`Q9SYM5`	Arabidopsis thaliana	sp\|Q9SYM5\|RHM1_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1	78.300%	Swiss-Prot	High
`Q9LH76`	Arabidopsis thaliana	sp\|Q9LH76\|RHM3_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM3	78.200%	Swiss-Prot	High
`Q9LPG6`	Arabidopsis thaliana	sp\|Q9LPG6\|RHM2_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2	78.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card