Gene Card
Gene overview
cDNA / CDS / Protein Sequences
994 bp · TkA07G333130|TK1151|cDNA
CCAGAACCAGATTTTAATCGTTTATATATATCTTCTTCTCAAGTAAATAACCTGTTCTGCAAAATTCCGTCGATGGCGACCTATCAAGAAGCAATCGATACATTCATGAGCATCACCGGTTCATCTAACGCTTGCTATACAGAAACTCACGGAGCATGGTGGAGATCTCAATGCAGCTGTCAATCACATTTCATGGAAGGAGATAGAAACATCAAGACACACAACCTCCATTGCTGCTCCACCTGATGATTTCATGGACG...
741 bp · TkA07G333130|TK1151|CDS
ATGGACGTAGATGATCCAACTCTTGCATCTCAACAGACCTCCTCTCTCTCTTTCCCTTCTTCTAGAGACATCAACATCAACCCATTCTCTCTCCTTGATCCAAACTTCACCCGAAGCATACTTGACAGTGGGCCAGGGACAGGGTTCAGTGGTAGTGAACCATTTGTGTCCCATCCAAGAGAAGTAAGGCAGATTCCCATTGAGGTCATTGATGGACCAAATACGGAATCAGATCATTCCGGAATCGCTCCAAGAATCGA...
Protein
Download Protein FASTA246 aa · TkA07G333130|TK1151|PROTEIN
MDVDDPTLASQQTSSLSFPSSRDININPFSLLDPNFTRSILDSGPGTGFSGSEPFVSHPREVRQIPIEVIDGPNTESDHSGIAPRIEDVTETTTENVPETRARVIIEDDDDDDDDNDYFPPSLPSRVTASAPGISDSIPPDHGIEEEMIRAAIEASKQDSQIGQQEDADRVPNPRPLEDPELAQAVFSIFKGLCYNSILFSSFLYPFIIDDFRLLSKKKALRQQGSEVAHQNHEILNWLRWKKWEH
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G333130 |
|---|---|
| TK1151 ID | TkA07G333130 |
| OH-1004 ID | LXL04_026481 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 38.000 |
| Protein coverage (%) | TK1151 42.276 / OH-1004 20.614Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G333130 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:83292832-83294504 (+) | |||||||||
| Description | Similar to PUX8: Plant UBX domain-containing protein 8 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0016192 vesicle-mediated transport Biological Process GO:0036337 Fas signaling pathway Biological Process GO:0036503 ERAD pathway Biological Process GO:0042176 regulation of protein catabolic process Biological Process GO:0043124 negative regulation of canonical NF-kappaB signal transduction Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0045732 positive regulation of protein catabolic process Biological Process GO:0045740 positive regulation of DNA replication Biological Process GO:1905691 lipid droplet disassembly Biological Process GO:0005634 nucleus Cellular Component GO:0005635 nuclear envelope Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT4G00752 ath:AT4G10790 ath:AT4G11740 ath:AT4G23040 hsa:11124 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF02809UIM111-111 aaPF02809UIM145-160 aaPF02809UIM178-185 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G333130 | PF02809 | UIM | 111 | 111 | 0.038 | 14.5 |
| TkA07G333130 | PF02809 | UIM | 145 | 160 | 0.038 | 14.5 |
| TkA07G333130 | PF02809 | UIM | 178 | 185 | 0.038 | 14.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.