RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G333070
Reference: TK1151 Chr: Chr07 Coordinates: 83262356-83268624 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2190 bp · TkA07G333070|TK1151|cDNA

AAAACCACCAAAAAAAACCCACAAGCTTCAGACACATACTCTCACGACTTGCAGAACGAACGAAGAAGATCGCGACTGTGTGTAAACACCGATCACTTCTTTGCATCAATTCGTCGATCAATCACCTTTTTCGAAATAGTGCTTCTGCTACAATTATATTCTAAACAAGATCCGAGACGAATGATTGGATGCCATTTGTATTGAATCCCTATACATGTCCGGGATATCTAATTCAGGTGTGAATGGCTCAACATCACATT...

CDS

Download CDS FASTA

897 bp · TkA07G333070|TK1151|CDS

ATGGGGATGGGCAACCTTGTTAACGGGGGCAATATTGGAAGAAGTTTAAGCTCTGGTGGACTCAATATGCCTGGGGTTGCTTCTCGTTTGAATCTAACTGCACCCCAGATGGTGTCTCTGCTAGGAAACTCATACTCTGGTGGTGGTGGCCCACTTTCACAAAATCAATTTCAAGGAGGGAATAGTCATTTAAGTTCAATGGCTTTGTTAAGTGAGCTGAATCGTGACCATTCTTTTGACATGAATGATTTCCCTCAGTT...

Protein

Download Protein FASTA

298 aa · TkA07G333070|TK1151|PROTEIN

MGMGNLVNGGNIGRSLSSGGLNMPGVASRLNLTAPQMVSLLGNSYSGGGGPLSQNQFQGGNSHLSSMALLSELNRDHSFDMNDFPQLSGHLASAGGSQRQLGGLARRQNVGFMQQNQEFSIQNEDFPALPGYKGGNADFPVNMHQKEQLRDTVVSMMQSQQHLPVGRSGGFSLGGAYSSHQQQQHAPINNNGPSYLPTNTQDLHFHASEARNTGMLPTGSRPTVSGGSYDQLMQQYQHFQKQSQIRLVSPFRDQDLKSPQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G333070
TK1151 IDTkA07G333070
OH-1004 IDLXL04_029650
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)98.500
Protein coverage (%)TK1151 89.597 / OH-1004 46.597
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G333070
LocationChr07:83262356-83268624 (+)
DescriptionSimilar to VIP2: Probable NOT transcription complex subunit VIP2 (Fragment)
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g59710 Transcriptional regulator required for Agrobacterium-mediated stable genetic transformation by T-DNA integration in host genome, but not for T-DNA transient expression. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_029650 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process
GO:0000289 nuclear-transcribed mRNA poly(A) tail shortening Biological Process
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0006357 regulation of transcription by RNA polymerase II Biological Process
GO:0006417 regulation of translation Biological Process
GO:0010606 positive regulation of cytoplasmic mRNA processing body assembly Biological Process
GO:0015074 DNA integration Biological Process
GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process
GO:0032968 positive regulation of transcription elongation by RNA polymerase II Biological Process
GO:0033147 negative regulation of intracellular estrogen receptor signaling pathway Biological Process
GO:2000036 regulation of stem cell population maintenance Biological Process
KEGG gene cross-reference
ath:AT5G59710
hsa:4848
mmu:72068
spo:2538778
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.668
Rank 1 · TkA07G333070 · TK1151
Nucleus0.349
Rank 2 · TkA07G333070 · TK1151
Cell membrane0.060
Rank 3 · TkA07G333070 · TK1151
Golgi apparatus0.050
Rank 4 · TkA07G333070 · TK1151
Lysosome / Vacuole0.047
Rank 5 · TkA07G333070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FPW4Arabidopsis thalianasp|Q9FPW4|VIP2_ARATH Probable NOT transcription complex subunit VIP246.500%Swiss-ProtMedium

JBrowse

View in Genome Browser