TkA07G329420 | RubberDandelionOmics

Gene overview

TkA07G329420

Reference: TK1151 Chr: Chr07 Coordinates: 82355855-82359373 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1766 bp · TkA07G329420|TK1151|cDNA

AAAAGGTTTTGTCATTTGTGATTGTTTGCAAGTACTATACAATTCAAAACACCTCAAACCCGTTTCACTTTTGTCTTTACCCTCCTTCATCTTTCTCTTTCCCAAAACTCCTTTTCCTTTATCATTTCATCTGCAATTTCAAATCTAGGGTTTTTTCCTTTTCACTTGCACAACCACCTCACCACCTCCTCTCCCTTTTGCCGTCGTACACAGGTTCGTCTGTGCTAATTGATTCTCTGTTTCTACATTCTCTGAATTTT...

CDS

Download CDS FASTA

1017 bp · TkA07G329420|TK1151|CDS

ATGGACGGAAGGGACGGAATCCCTTCGTTTTATCTCAATAGAGGGTTTCGTGGGTCGGATTCTAATGCCGGGTCGGGTAATCAAGGTGGAGGGTTCCATGCCCCTCCACCTGGTTTCAAAACTCAGTTACACCCTAATTTATCTCCCCATAGTCATAGCCAAATGAGGGTAGCTCCTTCAATGGGTTCTTCATTCCATTTGGACCACAACCCACCTCCTAGTTTCCCTCATAGCCTTAACATCGGCGTCGGTGGTGTTAG...

Protein

Download Protein FASTA

338 aa · TkA07G329420|TK1151|PROTEIN

MDGRDGIPSFYLNRGFRGSDSNAGSGNQGGGFHAPPPGFKTQLHPNLSPHSHSQMRVAPSMGSSFHLDHNPPPSFPHSLNIGVGGVSGDGGAGVGGGGGGGGGGTEDGAVAVSITPPGSGNDSVMKKKRGRPRKYAPEGSNMALALLKPVAPATSPDSNTPASQKKRGRPRGSGRKQQLANVGEWMHNSAGSAFTPHIIQISIGEDVAEKVLSFAQQRQRALCILSGNGSVSTVTLRQLTSSGGTMTYEGRFEILCLSGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G329420`
TK1151 ID	TkA07G329420
OH-1004 ID	LXL04_026454
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	63.700
Protein coverage (%)	TK1151 99.112 / OH-1004 89.946 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G329420

Location Chr07:82355855-82359373 (+)

Description Similar to AHL5: AT-hook motif nuclear-localized protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g63470`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	No verified direct reference in this release
`At1g63480`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	No verified direct reference in this release
`At3g61310`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	No verified direct reference in this release
`At4g12080`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	Identification of a novel plant MAR DNA binding protein localized on chromosomal surfaces.2004 · DOI: 10.1007/s11103-004-3249-5
`At4g22770`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026454 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0098687 chromosomal region Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003680 minor groove of adenine-thymine-rich DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G63470

ath:AT1G63480

ath:AT2G45850

ath:AT3G61310

ath:AT4G12080

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.978

Rank 1 · TkA07G329420 · TK1151

Cytoplasm0.079

Rank 2 · TkA07G329420 · TK1151

Cell membrane0.022

Rank 3 · TkA07G329420 · TK1151

Endoplasmic reticulum0.014

Rank 4 · TkA07G329420 · TK1151

Plastid0.011

Rank 5 · TkA07G329420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02178AT_hook126-137 aa

PF02178AT_hook165-173 aa

PF03479PCC189-309 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G329420	`PF02178`	AT_hook	126	137	0.038	14.5
TkA07G329420	`PF02178`	AT_hook	165	173	0.038	14.5
TkA07G329420	`PF03479`	PCC	189	309	1e-33	116.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GXB3`	Arabidopsis thaliana	sp\|Q8GXB3\|AHL5_ARATH AT-hook motif nuclear-localized protein 5	41.900%	Swiss-Prot	Medium
`Q8LPN5`	Arabidopsis thaliana	sp\|Q8LPN5\|AHL12_ARATH AT-hook motif nuclear-localized protein 12	44.200%	Swiss-Prot	Medium
`Q8L7L5`	Arabidopsis thaliana	sp\|Q8L7L5\|AHL11_ARATH AT-hook motif nuclear-localized protein 11	51.200%	Swiss-Prot	Medium
`Q8VYJ2`	Arabidopsis thaliana	sp\|Q8VYJ2\|AHL1_ARATH AT-hook motif nuclear-localized protein 1	50.200%	Swiss-Prot	Medium
`O49658`	Arabidopsis thaliana	sp\|O49658\|AHL2_ARATH AT-hook motif nuclear-localized protein 2	46.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card