Gene Card
Gene overview
cDNA / CDS / Protein Sequences
333 bp · TkA07G327980|TK1151|cDNA
GGTGAACCGTGTCCACCTTCTTCAACCCGCTGTCATCCTGAACCCGCTGAACCCGAAGAAGGAGGTATCGTCGTCTTCCCGAGCCCGCCGCCTGCTAACCCGCTACCTGCGATTTCCTTCTTCACCCGCCAGCTTCTGCGGGCTCACGAACCCGCCACAACCACAACTTCCTTCTTCAATCTTCTATCCCACGATCCCGCTCGGCTTCAATCTTCTATCCCGCGAACCCACTCTGTACTCGACACCGTTCACAAATTAGT...
333 bp · TkA07G327980|TK1151|CDS
GGTGAACCGTGTCCACCTTCTTCAACCCGCTGTCATCCTGAACCCGCTGAACCCGAAGAAGGAGGTATCGTCGTCTTCCCGAGCCCGCCGCCTGCTAACCCGCTACCTGCGATTTCCTTCTTCACCCGCCAGCTTCTGCGGGCTCACGAACCCGCCACAACCACAACTTCCTTCTTCAATCTTCTATCCCACGATCCCGCTCGGCTTCAATCTTCTATCCCGCGAACCCACTCTGTACTCGACACCGTTCACAAATTAGT...
Protein
Download Protein FASTA110 aa · TkA07G327980|TK1151|PROTEIN
GEPCPPSSTRCHPEPAEPEEGGIVVFPSPPPANPLPAISFFTRQLLRAHEPATTTTSFFNLLSHDPARLQSSIPRTHSVLDTVHKLVFIDLWRIGFSFGFLFGDGNFGGK
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G327980 |
|---|---|
| TK1151 ID | TkA07G327980 |
| OH-1004 ID | LXL04_009589 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 50.900 |
| Protein coverage (%) | TK1151 48.182 / OH-1004 7.981Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G327980 |
|---|---|
| Location | Chr07:82031423-82031755 (-) |
| Description | Similar to At3g47830: Putative DNA glycosylase At3g47830 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006281 DNA repair Biological Process GO:0006284 base-excision repair Biological Process GO:0006285 base-excision repair, AP site formation Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0040029 epigenetic regulation of gene expression Biological Process GO:0050832 defense response to fungus Biological Process GO:0141166 chromosomal 5-methylcytosine DNA demethylation pathway Biological Process GO:0141169 chromosomal 5-methylcytosine DNA demethylation, direct 5-methylcytosine excision pathway Biological Process GO:0005634 nucleus Cellular Component GO:0005730 nucleolus Cellular Component GO:0005739 mitochondrion Cellular Component GO:0003677 DNA binding Molecular Function |
| KEGG gene cross-reference | ath:AT2G36490 ath:AT3G47830 dosa:Os01g0217900 dosa:Os05g0445900 osa:9271145 sai:Saci_1497 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.