Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2904 bp · TkA07G327620|TK1151|cDNA
ATCAAATCGCCATTTCCACACCTCTCCCATTCGACCTCTGTCAAATTCTCCTGCTGCAATCCATCTTCGGGTCCGTCTAGTTACCGTCGTCGAATCCGATCACCGGTAGAGATGAGCGGACACGATTCGAAGTACTTTTCCACAACTAAAAAGGGAGAAATCCCCGAGCTCAAAGAAGAACTCAATTCTCAGTACAAGGATAAGAGAAAAGATGCTGTTAAAAAGGTGATTGCTGCCATGACTGTTGGGAAGGACGTGTC...
1311 bp · TkA07G327620|TK1151|CDS
ATGATTTGGATCATCGGTGAATATGCTGAAAGAATCGATAACGCTGATGAACTTCTCGAAAGCTTCCTCGAGACTTTCCCTGAAGAACCCGCACAAGTTCAGTTACAGTTACTAACCGCCACTGTCAAACTTTTCCTCAAAAAACCAACCGAAGGCCCACAACAAATGATTCAAGTTGTTTTAAATAACGCGACTGTGGAAACCGACAACCCCGATCTCCGAGATCGCGCTTACATATACTGGCGCCTTCTATCAACCGA...
Protein
Download Protein FASTA436 aa · TkA07G327620|TK1151|PROTEIN
MIWIIGEYAERIDNADELLESFLETFPEEPAQVQLQLLTATVKLFLKKPTEGPQQMIQVVLNNATVETDNPDLRDRAYIYWRLLSTDPEAAKDVVLAEKPVISDDSNQLDSSLLDELLANIATLSSVYHKPPESFITRVKTVEKTEEEEFPEGVEGGGYTETSSSLVVDTGATPPPPPAIPDLLDLMGLDGGDDTSAIVPVDQPAASMLPVLLPAASGQGLEISAQLIRKDGQLFYSLMFENNTNIALDGFMIQFNKNTF...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G327620 |
|---|---|
| TK1151 ID | TkA07G327620 |
| OH-1004 ID | LXL04_029599 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 98.600 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 49.434Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G327620 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:81947110-81951706 (+) | |||||||||
| Description | Similar to BETAC-AD: Beta-adaptin-like protein C | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006886 intracellular protein transport Biological Process GO:0006897 endocytosis Biological Process GO:0016192 vesicle-mediated transport Biological Process GO:0045807 positive regulation of endocytosis Biological Process GO:0048268 clathrin coat assembly Biological Process GO:0072583 clathrin-dependent endocytosis Biological Process GO:1905477 positive regulation of protein localization to membrane Biological Process GO:0005634 nucleus Cellular Component GO:0005802 trans-Golgi network Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0005905 clathrin-coated pit Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT4G11380 ath:AT4G23460 mmu:71770 rno:140670 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01602Adaptin_N1-87 aaPF02883Alpha_adaptinC232-61 aaPF09759Atx10homo_assoc55-111 aaPF02883Alpha_adaptinC2219-314 aaPF09066B2-adapt-app_C326-434 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G327620 | PF01602 | Adaptin_N | 1 | 87 | 2.6e-22 | 79.8 |
| TkA07G327620 | PF02883 | Alpha_adaptinC2 | 32 | 61 | 2.4e-08 | 34.9 |
| TkA07G327620 | PF09759 | Atx10homo_assoc | 55 | 111 | 0.054 | 14.1 |
| TkA07G327620 | PF02883 | Alpha_adaptinC2 | 219 | 314 | 2.4e-08 | 34.9 |
| TkA07G327620 | PF09066 | B2-adapt-app_C | 326 | 434 | 3.4e-33 | 114.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.