TkA07G324910 | RubberDandelionOmics

Gene overview

TkA07G324910

Reference: TK1151 Chr: Chr07 Coordinates: 81357047-81361296 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2855 bp · TkA07G324910|TK1151|cDNA

CGAAAACATCCTCACTTATTTGCCACTTTCTATTGCATTTATGCAATTATGCTATATCCTTGAATGTAAAAGAAAATAATCCCAATCAATCGGTCCTAAGAACCGTGATGTCAAGACTAAGACTATAACCTGAATTTGAGAACTACTAATAATTTTCACCTCCTAGTTTGAAACATAAAATCTGACTGAACAATAAAAATTTATTTACTCAGGGACGAGCATTCGCTATCCCTCATGATTTGGGGTTATTTTGGTGCAAA...

CDS

Download CDS FASTA

1926 bp · TkA07G324910|TK1151|CDS

ATGGGCGTCGCGATGTCAATCACCGCGTTCCCGGTCCTCGCACGGATTCTAGCCGAACTCAAGCTCTTAACCACCGAAGTCGGTAAAATGGCCATGTCAGCAGCGGCTGTTAACGACATAGTCGCGTGGATTCTACTCGCGCTTGCAGTTGCCCTTTCGGGTTCAGGGCGGTCCCCACTTGTAGCCCTATGGGTTTTTCTATGTGCGACTGGTTTTGTGATTTTGTGCTCGGTTTTGGTGCCCCCAGTTTTCAGATGGAT...

Protein

Download Protein FASTA

641 aa · TkA07G324910|TK1151|PROTEIN

MGVAMSITAFPVLARILAELKLLTTEVGKMAMSAAAVNDIVAWILLALAVALSGSGRSPLVALWVFLCATGFVILCSVLVPPVFRWMSQRCPDGEPVDELYVCVTLGGVLAASFVTDAIGIHALFGAFVVGVLIPKEGAFAVALVEKVEDLVSGLFLPLYFASSGLKTNIGAIKGARSWGLLVLVIFTACFGKIAGSVGVSLLCRIPWMDALAIGLLMNTKGLVEIIVLNIGKDRGVLDDETFAILVLMALLTTFITTPL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G324910`
TK1151 ID	TkA07G324910
OH-1004 ID	LXL04_026380
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	72.900
Protein coverage (%)	TK1151 100.000 / OH-1004 79.332 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G324910

Location Chr07:81357047-81361296 (+)

Description Similar to CHX17: Cation/H(+) antiporter 17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g41610`	May operate as a cation/H(+) antiporter.	No verified direct reference in this release
`At4g23700`	Operates as a K(+)/H(+) antiporter that controls K(+) acquisition and homeostasis.	Characterization of AtCHX17, a member of the cation/H+ exchangers, CHX family, from Arabidopsis thaliana suggests a role in K+ homeostasis.2004 · DOI: 10.1111/j.1365-313x.2004.02177.x Arabidopsis thaliana CHX17 gene complements the kha1 deletion phenotypes in Saccharomyces cerevisiae.2006 · DOI: 10.1002/yea.1424
`At3g17630`	May operate as a cation/H(+) antiporter.	No verified direct reference in this release
`At1g64170`	May operate as a cation/H(+) antiporter.	No verified direct reference in this release
`At2g13620`	May operate as a cation/H(+) antiporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026380 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006623 protein targeting to vacuole Biological Process

GO:0006813 potassium ion transport Biological Process

GO:0006885 regulation of pH Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:1902600 proton transmembrane transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005770 late endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0016020 membrane Cellular Component

GO:0015297 antiporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G64170

ath:AT2G13620

ath:AT3G17630

ath:AT4G23700

ath:AT5G41610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.832

Rank 1 · TkA07G324910 · TK1151

Endoplasmic reticulum0.096

Rank 2 · TkA07G324910 · TK1151

Cytoplasm0.066

Rank 3 · TkA07G324910 · TK1151

Lysosome / Vacuole0.047

Rank 4 · TkA07G324910 · TK1151

Nucleus0.034

Rank 5 · TkA07G324910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00999Na_H_Exchanger1-260 aa

PF23987Phage_holin_10102-130 aa

PF23987Phage_holin_10235-257 aa

PF23256CHX17_2nd324-451 aa

PF23259CHX17_C466-617 aa

PF23256CHX17_2nd538-549 aa

PF00999Na_H_Exchanger584-617 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G324910	`PF00999`	Na_H_Exchanger	1	260	1.4e-43	150.0
TkA07G324910	`PF23987`	Phage_holin_10	102	130	0.68	10.9
TkA07G324910	`PF23987`	Phage_holin_10	235	257	0.68	10.9
TkA07G324910	`PF23256`	CHX17_2nd	324	451	4.1e-40	137.5
TkA07G324910	`PF23259`	CHX17_C	466	617	8.7e-26	91.5
TkA07G324910	`PF23256`	CHX17_2nd	538	549	4.1e-40	137.5
TkA07G324910	`PF00999`	Na_H_Exchanger	584	617	1.4e-43	150.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFR9`	Arabidopsis thaliana	sp\|Q9FFR9\|CHX18_ARATH Cation/H(+) antiporter 18	61.100%	Swiss-Prot	High
`Q9SUQ7`	Arabidopsis thaliana	sp\|Q9SUQ7\|CHX17_ARATH Cation/H(+) antiporter 17	60.800%	Swiss-Prot	High
`Q9LUN4`	Arabidopsis thaliana	sp\|Q9LUN4\|CHX19_ARATH Cation/H(+) antiporter 19	59.800%	Swiss-Prot	High
`Q1HDT3`	Arabidopsis thaliana	sp\|Q1HDT3\|CHX16_ARATH Cation/H(+) antiporter 16	52.100%	Swiss-Prot	High
`Q9SIT5`	Arabidopsis thaliana	sp\|Q9SIT5\|CHX15_ARATH Cation/H(+) antiporter 15	47.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card