TkA07G322680 | RubberDandelionOmics

Gene overview

TkA07G322680

Reference: TK1151 Chr: Chr07 Coordinates: 80782978-80783475 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

498 bp · TkA07G322680|TK1151|cDNA

ATTTACTACGGCGACGAAGAATCAAATTATCACTATATTTATTCCTTTTTCTACTTCTTTTTCCAAGTGCGGGATAAGCTCAAGGGGTTGTGGGTTTTTTTTCTACCAATTGGGGCCCTCCCTTCACCACCCCCATGTGGATGGTCTACAGGGTTCATAACTACTCCTCTTACTACATGGCACTTACCTAGCCAACGCTTAGATCCAGCTCTACCTAAACTTTTCTGGTTCACCCCAACATTCCCCACTTGTCCGACTGT...

CDS

Download CDS FASTA

498 bp · TkA07G322680|TK1151|CDS

ATTTACTACGGCGACGAAGAATCAAATTATCACTATATTTATTCCTTTTTCTACTTCTTTTTCCAAGTGCGGGATAAGCTCAAGGGGTTGTGGGTTTTTTTTCTACCAATTGGGGCCCTCCCTTCACCACCCCCATGTGGATGGTCTACAGGGTTCATAACTACTCCTCTTACTACATGGCACTTACCTAGCCAACGCTTAGATCCAGCTCTACCTAAACTTTTCTGGTTCACCCCAACATTCCCCACTTGTCCGACTGT...

Protein

Download Protein FASTA

165 aa · TkA07G322680|TK1151|PROTEIN

IYYGDEESNYHYIYSFFYFFFQVRDKLKGLWVFFLPIGALPSPPPCGWSTGFITTPLTTWHLPSQRLDPALPKLFWFTPTFPTCPTVAEQFLDIKRISPEGNFNVADFPSFPTSFATAPAALANCPPFPSLISMLCMVVPKGFSSVLETILSSPYYYISRVNNFI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G322680`
TK1151 ID	TkA07G322680
OH-1004 ID	LXL04_040138
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	88.800
Protein coverage (%)	TK1151 53.939 / OH-1004 10.974 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G322680

Location Chr07:80782978-80783475 (+)

Description Similar to matK: Maturase K

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: P0C308`	Uncharacterized protein ycf72.	No verified direct reference in this release
`UniProt: P0C309`	Uncharacterized protein ycf72.	No verified direct reference in this release
`UniProt: Q36996`	Uncharacterized protein ycf72.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_040138 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0008033 tRNA processing Biological Process

GO:0008380 RNA splicing Biological Process

GO:0009507 chloroplast Cellular Component

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

han:4055638

lsv:3772834

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.336

Rank 1 · TkA07G322680 · TK1151

Mitochondrion0.250

Rank 2 · TkA07G322680 · TK1151

Nucleus0.233

Rank 3 · TkA07G322680 · TK1151

Cell membrane0.107

Rank 4 · TkA07G322680 · TK1151

Plastid0.091

Rank 5 · TkA07G322680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0C308`	Oryza sativa	sp\|P0C308\|YCF72_ORYSA Uncharacterized protein ycf72	76.100%	Swiss-Prot	Medium
`P0C309`	Oryza sativa subsp. indica	sp\|P0C309\|YCF72_ORYSI Uncharacterized protein ycf72	76.100%	Swiss-Prot	Medium
`Q36996`	Oryza sativa subsp. japonica	sp\|Q36996\|YCF72_ORYSJ Uncharacterized protein ycf72	76.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card