TkA07G316790 | RubberDandelionOmics

Gene overview

TkA07G316790

Reference: TK1151 Chr: Chr07 Coordinates: 79399777-79403081 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1914 bp · TkA07G316790|TK1151|cDNA

CTCTCTCTCTCTCTCATTAATCAACAATTTGGTTGTCTTTATTCGTGGTTTCTTTTTGTCAAGAGCCTAAAATGGGAAAGCAAATAGGGGATTTACGTAAAGTGCAAACGCTATTAAACCATGTAAAGAAACTACTGTATTAGAATTTAGAAGACTAAAAGTAAAAAAACAAAGAGGGGAAGGATGACGTTTTACCTTTGGGCTTTGGTAGATTTGCTTCTATTGATAGGCCCATCAGTTAAAAGACAGAGTGGAGTTTA...

CDS

Download CDS FASTA

1227 bp · TkA07G316790|TK1151|CDS

ATGGAAAATTCAAGGCTTGCTTTTCTATTTACTGGGTTGATATTGCCTCTGTTGGTGGCTTCGGTAGGGATAAACTATGGACAGATCGCCAACAATCTTCCGTCGCCGGAACATGTTGTTCCGTTGGTGAAAGCCATTGGTGCCACCAGAGTGAAGCTCTATGACGCCGACCCTAAGGTTCTGAAAGCTTTTGCGAACACGGGGGTTGAGTTTATTGTGGGGCTTGGTAACGAATACCTATCGAAGATGACAGATCCAGC...

Protein

Download Protein FASTA

408 aa · TkA07G316790|TK1151|PROTEIN

MENSRLAFLFTGLILPLLVASVGINYGQIANNLPSPEHVVPLVKAIGATRVKLYDADPKVLKAFANTGVEFIVGLGNEYLSKMTDPANAQAWVKSNVQCYLPATKIVSIAVGNEVLTFNDTSLSGCLLPAMQSVHTALVNLKLDSQVTVTTAHSVAILQSSYPPSTGAFRQDLKGCIAPILDFLSKTCSPFLINAYPFFAYKANPKQVSLDFVLFQPNAGIVDPRTNLHYDNMLFAQIDAVYAALASLGYKKLPVQISET...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G316790`
TK1151 ID	TkA07G316790
OH-1004 ID	LXL04_029445
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 94.853 / OH-1004 91.489 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G316790

Location Chr07:79399777-79403081 (-)

Description Similar to At1g32860: Glucan endo-1,3-beta-glucosidase 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g32860`	Glucan endo-1,3-beta-glucosidase 11.	No verified direct reference in this release
`At5g42100`	Plasmodesmal-associated membrane beta-1,3-glucanase involved in plasmodesmal callose degradation and functions in the gating of plasmodesmata.	No verified direct reference in this release
`At2g27500`	Glucan endo-1,3-beta-glucosidase 14.	No verified direct reference in this release
`At4g34480`	Glucan endo-1,3-beta-glucosidase 7.	No verified direct reference in this release
`At4g29360`	Glucan endo-1,3-beta-glucosidase 12.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029445 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006076 (1->3)-beta-D-glucan catabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0007154 cell communication Biological Process

GO:0034407 cell wall (1->3)-beta-D-glucan metabolic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0140547 acquisition of seed longevity Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G32860

ath:AT2G27500

ath:AT4G34480

ath:AT5G42100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.696

Rank 1 · TkA07G316790 · TK1151

Extracellular0.129

Rank 2 · TkA07G316790 · TK1151

Endoplasmic reticulum0.083

Rank 3 · TkA07G316790 · TK1151

Cytoplasm0.078

Rank 4 · TkA07G316790 · TK1151

Lysosome / Vacuole0.042

Rank 5 · TkA07G316790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00332Glyco_hydro_1722-340 aa

PF29664BtgE-BtgC_glyc-hydro42-207 aa

PF29664BtgE-BtgC_glyc-hydro242-323 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G316790	`PF00332`	Glyco_hydro_17	22	340	1e-84	285.5
TkA07G316790	`PF29664`	BtgE-BtgC_glyc-hydro	42	207	1.7e-15	57.7
TkA07G316790	`PF29664`	BtgE-BtgC_glyc-hydro	242	323	1.7e-15	57.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L868`	Arabidopsis thaliana	sp\|Q8L868\|E1311_ARATH Glucan endo-1,3-beta-glucosidase 11	66.800%	Swiss-Prot	High
`Q9FHX5`	Arabidopsis thaliana	sp\|Q9FHX5\|E1310_ARATH Glucan endo-1,3-beta-glucosidase 10	66.300%	Swiss-Prot	High
`Q9ZQG9`	Arabidopsis thaliana	sp\|Q9ZQG9\|E1314_ARATH Glucan endo-1,3-beta-glucosidase 14	59.700%	Swiss-Prot	High
`Q9M069`	Arabidopsis thaliana	sp\|Q9M069\|E137_ARATH Glucan endo-1,3-beta-glucosidase 7	46.800%	Swiss-Prot	Medium
`Q8VYE5`	Arabidopsis thaliana	sp\|Q8VYE5\|E1312_ARATH Glucan endo-1,3-beta-glucosidase 12	43.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card