Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1506 bp · TkA07G309870|TK1151|cDNA
GTTTTGCACCACCCTCAGTTACATTTGTATGAGGCTTTTAGGGGAAGGGGTGGATGGTGGTCTAAATGGTGCATGCACCAAAGCCCGCAAATGGATTTTGGATCATGGCTCTGTCACCGCCATTCCATCATGGGGCAAAACATGGCTTTCCGAAGATTTATATTATCCTTATCCATTACTACAAGATTTAATGTGGGATAGTCTCTATATTTGCACTGAGCCTCTATTAAATCGCTGGCCATTAAATAAATTACGTCAAA...
1455 bp · TkA07G309870|TK1151|CDS
ATGAACTATACTTACAACCTTACAATGAAATCAACTGGAAGAGCATACGTCATTTGTGTGCTAAGCTTATCATTTCAGGAAGATTTATATTATCCTTATCCATTACTACAAGATTTAATGTGGGATAGTCTCTATATTTGCACTGAGCCTCTATTAAATCGCTGGCCATTAAATAAATTACGTCAAAAAGCACTCGATACAACAATGAAACATATTCATTATGAAGATGAGAATAGCCGTTATATCACCATTGGTTCGGT...
Protein
Download Protein FASTA484 aa · TkA07G309870|TK1151|PROTEIN
MNYTYNLTMKSTGRAYVICVLSLSFQEDLYYPYPLLQDLMWDSLYICTEPLLNRWPLNKLRQKALDTTMKHIHYEDENSRYITIGSVVKVLCMFACWVEEPNGVCFKKHIARIPDYIWVAEDGMKMQSFGSQEWDASLAIQALLATDLTDEIGSTLMKGHQFIKASQVKDNPSRDFKSMHRHISKGSWSFSDQDHGWQSSDTTAEALKCCLLFSTMPPELVGENMKPEQLNDAVDVILSLQSKNGRLASWEPAGSSEWLE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G309870 |
|---|---|
| TK1151 ID | TkA07G309870 |
| OH-1004 ID | LXL04_029395 |
| Relationship / confidence | Multi Candidate From Tk1151 / Complex relationship |
| Protein identity (%) | 90.800 |
| Protein coverage (%) | TK1151 94.628 / OH-1004 89.126Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G309870 |
|---|---|
| Location | Chr07:77784206-77788834 (+) |
| Description | Similar to OSCPNY1: Beta-amyrin synthase 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0002238 response to molecule of fungal origin Biological Process GO:0009723 response to ethylene Biological Process GO:0009753 response to jasmonic acid Biological Process GO:0010038 response to metal ion Biological Process GO:0016104 triterpenoid biosynthetic process Biological Process GO:0042542 response to hydrogen peroxide Biological Process GO:0071731 response to nitric oxide Biological Process GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005811 lipid droplet Cellular Component GO:0016866 intramolecular transferase activity Molecular Function GO:0042300 beta-amyrin synthase activity Molecular Function |
| KEGG gene cross-reference | ag:BAA33461 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF14123DUF429038-100 aaPF13249SQHop_cyclase_N52-78 aaPF07678TED_complement118-143 aaPF13243SQHop_cyclase_C133-462 aaPF20652Sec8_C140-227 aaPF09492Pec_lyase143-172 aaPF00432Prenyltrans218-324 aaPF13249SQHop_cyclase_N225-245 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G309870 | PF14123 | DUF4290 | 38 | 100 | 0.098 | 12.9 |
| TkA07G309870 | PF13249 | SQHop_cyclase_N | 52 | 78 | 0.033 | 14.1 |
| TkA07G309870 | PF07678 | TED_complement | 118 | 143 | 0.00058 | 19.8 |
| TkA07G309870 | PF13243 | SQHop_cyclase_C | 133 | 462 | 4.2e-41 | 141.7 |
| TkA07G309870 | PF20652 | Sec8_C | 140 | 227 | 0.21 | 11.6 |
| TkA07G309870 | PF09492 | Pec_lyase | 143 | 172 | 0.01 | 15.9 |
| TkA07G309870 | PF00432 | Prenyltrans | 218 | 324 | 0.00021 | 21.6 |
| TkA07G309870 | PF13249 | SQHop_cyclase_N | 225 | 245 | 0.033 | 14.1 |
| TkA07G309870 | PF07678 | TED_complement | 229 | 262 | 0.00058 | 19.8 |
| TkA07G309870 | PF09492 | Pec_lyase | 285 | 325 | 0.01 | 15.9 |
| TkA07G309870 | PF07678 | TED_complement | 288 | 427 | 0.00058 | 19.8 |
| TkA07G309870 | PF13249 | SQHop_cyclase_N | 307 | 324 | 0.033 | 14.1 |
| TkA07G309870 | PF13249 | SQHop_cyclase_N | 310 | 375 | 0.033 | 14.1 |
| TkA07G309870 | PF00432 | Prenyltrans | 336 | 442 | 0.00021 | 21.6 |
| TkA07G309870 | PF09492 | Pec_lyase | 354 | 378 | 0.01 | 15.9 |
| TkA07G309870 | PF09492 | Pec_lyase | 409 | 437 | 0.01 | 15.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.