TkA07G307320 | RubberDandelionOmics

Gene overview

TkA07G307320

Reference: TK1151 Chr: Chr07 Coordinates: 77155197-77155708 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

372 bp · TkA07G307320|TK1151|cDNA

ATGGCCTCATCTGTGAGCAATTCAGGTGTTTCATTATCACCCATTTTGGTTCTAAAGGAACACCATAGAATGCGTTCATGCGGTTTTGTAAAGATCGATGGAGCTTCTTCTGTTAACAAGAAGAACACCATTGTAGCATGTCATAAATATAATGATGAAGGAAAAAAGAGTGAAAGGTTGGAACCTTTGTGGGATGATGGTTATGGGACACAAACCATGAAAGATTACACAAAAATAGCCATGGATTTGGTTAAGAGTGA...

CDS

Download CDS FASTA

372 bp · TkA07G307320|TK1151|CDS

ATGGCCTCATCTGTGAGCAATTCAGGTGTTTCATTATCACCCATTTTGGTTCTAAAGGAACACCATAGAATGCGTTCATGCGGTTTTGTAAAGATCGATGGAGCTTCTTCTGTTAACAAGAAGAACACCATTGTAGCATGTCATAAATATAATGATGAAGGAAAAAAGAGTGAAAGGTTGGAACCTTTGTGGGATGATGGTTATGGGACACAAACCATGAAAGATTACACAAAAATAGCCATGGATTTGGTTAAGAGTGA...

Protein

Download Protein FASTA

123 aa · TkA07G307320|TK1151|PROTEIN

MASSVSNSGVSLSPILVLKEHHRMRSCGFVKIDGASSVNKKNTIVACHKYNDEGKKSERLEPLWDDGYGTQTMKDYTKIAMDLVKSDGGPPRFFTIYLLECVTFEGMDGIGTGLVVHEKALGK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G307320`
TK1151 ID	TkA07G307320
OH-1004 ID	LXL04_029370
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	80.900
Protein coverage (%)	TK1151 81.301 / OH-1004 45.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G307320

Location Chr07:77155197-77155708 (-)

Description Similar to At1g54570: Acyltransferase-like protein At1g54570, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g54570`	Acyltransferase involved in fatty acid phytyl ester synthesis in chloroplasts, a process required for the maintenance of the photosynthetic membrane integrity during abiotic stress and senescence.	Fatty acid phytyl ester synthesis in chloroplasts of Arabidopsis.2012 · DOI: 10.1105/tpc.112.095588

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029370 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006995 cellular response to nitrogen starvation Biological Process

GO:0010150 leaf senescence Biological Process

GO:0010866 regulation of triglyceride biosynthetic process Biological Process

GO:0019432 triglyceride biosynthetic process Biological Process

GO:0033306 phytol metabolic process Biological Process

GO:0090693 plant organ senescence Biological Process

GO:1904963 regulation of phytol biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0010287 plastoglobule Cellular Component

GO:0016020 membrane Cellular Component

GO:0004144 diacylglycerol O-acyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G54570

ath:AT3G26840

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.967

Rank 1 · TkA07G307320 · TK1151

Nucleus0.031

Rank 2 · TkA07G307320 · TK1151

Mitochondrion0.028

Rank 3 · TkA07G307320 · TK1151

Cytoplasm0.015

Rank 4 · TkA07G307320 · TK1151

Cell membrane0.012

Rank 5 · TkA07G307320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVN2`	Arabidopsis thaliana	sp\|Q9ZVN2\|PES1_ARATH Phytyl ester synthase 1, chloroplastic	46.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card