TkA07G306630 | RubberDandelionOmics

Gene overview

TkA07G306630

Reference: TK1151 Chr: Chr07 Coordinates: 76992955-76994734 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

982 bp · TkA07G306630|TK1151|cDNA

AAAAGTTCCAAACGAAACAAATTTGTTTTCTTCTATTTCTCATTTGAAAACGAAAACAATGAGCAGGGATTAATAAGATAAGAGCAGAAAATATAACCACTCAACTACTCACCGGATCTTCCATTAACGAAAACACGATGGACCTTCAAACGCCCTGCAATATTTTCTCTACCTCACATTACAGGAGTCCATCACTCTTCCGGCAATGTGCCCCGCCGAGAAATAAAATCAGCTACGCCGCGACTTCATCAAAATGTCGC...

CDS

Download CDS FASTA

636 bp · TkA07G306630|TK1151|CDS

ATGGACCTTCAAACGCCCTGCAATATTTTCTCTACCTCACATTACAGGAGTCCATCACTCTTCCGGCAATGTGCCCCGCCGAGAAATAAAATCAGCTACGCCGCGACTTCATCAAAATGTCGCCGTAGTACGACGTCGTCGGAGCTTCAAGCTCCACCCGTAGTACCTCGTTCCCAACGCATTTCTGTTGTTTCATCGGCTCCGAGCCATAAAGTCACCGTTCACGACAGACAACGAGATGTTGTTCACGAATTCTACGT...

Protein

Download Protein FASTA

211 aa · TkA07G306630|TK1151|PROTEIN

MDLQTPCNIFSTSHYRSPSLFRQCAPPRNKISYAATSSKCRRSTTSSELQAPPVVPRSQRISVVSSAPSHKVTVHDRQRDVVHEFYVPEDQYILHTAEAQDISLPFACRHGCCTSCAVRIKSGGLRQPEALGISAELKAQGYALLCVGFPTSDVEVETQDEDEVYWLQFGRYFARGPIERDDYALELAMGDETFEKNLVLYTSGVLFMSIR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G306630`
TK1151 ID	TkA07G306630
OH-1004 ID	LXL04_029356
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 90.995 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G306630

Location Chr07:76992955-76994734 (-)

Description Similar to FDC2: Ferredoxin C 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g32550`	Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions (Probable).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029356 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0022900 electron transport chain Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009055 electron transfer activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051537 2 iron, 2 sulfur cluster binding Molecular Function

KEGG gene cross-reference

ana:all4148

ath:AT1G32550

syc:syc1175_c

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.980

Rank 1 · TkA07G306630 · TK1151

Mitochondrion0.030

Rank 2 · TkA07G306630 · TK1151

Nucleus0.021

Rank 3 · TkA07G306630 · TK1151

Cytoplasm0.020

Rank 4 · TkA07G306630 · TK1151

Cell membrane0.010

Rank 5 · TkA07G306630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27082Znf_C2H2_Trps1_4th36-44 aa

PF00111Fer283-150 aa

PF27082Znf_C2H2_Trps1_4th83-117 aa

PF13085Fer2_397-121 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G306630	`PF27082`	Znf_C2H2_Trps1_4th	36	44	0.073	14.2
TkA07G306630	`PF00111`	Fer2	83	150	8.9e-14	51.9
TkA07G306630	`PF27082`	Znf_C2H2_Trps1_4th	83	117	0.073	14.2
TkA07G306630	`PF13085`	Fer2_3	97	121	0.17	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C7Y4`	Arabidopsis thaliana	sp\|Q9C7Y4\|FDC2_ARATH Ferredoxin C 2, chloroplastic	92.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card