RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G306560
Reference: TK1151 Chr: Chr07 Coordinates: 76972829-76976515 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1082 bp · TkA07G306560|TK1151|cDNA

AAAAAAACTAGCAAATGTATGTGTTTGCCCCACTCCAGAAATAATTGAAGTCCTGTTCATATCATACAAATATGTCATTAAAAGCCTCTTGAATGTGTCATCCATCCACTATATTTGATAAAGTCATGGCTTCTTAATCGCAAATCTTTATGTGGGTGTTCCAGATTTTACTACTTTTGGGTTTCCATGAATTTCACTGGTGAATTATGAGACTGAAGAAGGATTTTGTACTCCATGCTTCTAAAGTAGCCATCTTCGAC...

CDS

Download CDS FASTA

441 bp · TkA07G306560|TK1151|CDS

ATGCCAGTTCCCTTAGCTCCATACCCAACTCCTCATGTACCATTTACACCACCTGCTGCAACTGGTTCTGAAAGCCAACTAGTGTGTTCCGGATGTCGAAATCTTCTTCTTTACCCAATGGGAGCAACTACAGTTTGCTGTGCTGTTTGCAATTCCGTCACCGCTGTACCTCTTCCCGGTACCGAAATGGCACAATTAGTATGTGGAGGTTGCCACACTTTACTCATGTACATTCGTGGGGCTGCAAGTGTACAATGTTC...

Protein

Download Protein FASTA

146 aa · TkA07G306560|TK1151|PROTEIN

MPVPLAPYPTPHVPFTPPAATGSESQLVCSGCRNLLLYPMGATTVCCAVCNSVTAVPLPGTEMAQLVCGGCHTLLMYIRGAASVQCSCCHTINLALEGNQVAHINCGNCKMLLMYPNGARSVKCAVCQFVTSIGASASNIEQKSIA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G306560
TK1151 IDTkA07G306560
OH-1004 IDLXL04_029355
Relationship / confidenceRbh Sequence Supported / Probable
Protein identity (%)93.900
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G306560
LocationChr07:76972829-76976515 (+)
DescriptionSimilar to LOL1: Protein LOL1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g32540 Positive regulator of reactive oxygen-induced cell death.
Antagonistic control of oxidative stress-induced cell death in Arabidopsis by two related, plant-specific zinc finger proteins.2003 · DOI: 10.1073/pnas.1130421100
At4g20380 Negative regulator of reactive oxygen-induced cell death, cold stress-induced cell death, pathogen-induced hypersensitive response (HR), basal disease resistance.
The Arabidopsis LSD1 gene plays an important role in the regulation of low temperature-dependent cell death.2010 · DOI: 10.1111/j.1469-8137.2010.03275.x

Rice

Reference gene IDPossible functionPapers / DOI
Os08g0159500 Negative regulator of programmed cell death and hypersensitive response (HR).
OsLSD1, a rice zinc finger protein, regulates programmed cell death and callus differentiation.2005 · DOI: 10.1094/mpmi-18-0375
Os07g0472200 Putative zinc finger that may be involved in programmed cell death and defense response. No verified direct reference in this release
Os12g0611000 Putative zinc finger that may be involved in programmed cell death and defense response. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_029355 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009626 plant-type hypersensitive response Biological Process
GO:0030154 cell differentiation Biological Process
GO:0031348 negative regulation of defense response Biological Process
GO:0034051 negative regulation of plant-type hypersensitive response Biological Process
GO:0034052 positive regulation of plant-type hypersensitive response Biological Process
GO:0043068 positive regulation of programmed cell death Biological Process
GO:0045595 regulation of cell differentiation Biological Process
GO:0098542 defense response to other organism Biological Process
GO:2000121 regulation of removal of superoxide radicals Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005634 nucleus Cellular Component
GO:0003677 DNA binding Molecular Function
KEGG gene cross-reference
ath:AT1G32540
dosa:Os03g0639600
dosa:Os08g0159500
dosa:Os12g0611000
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.558
Rank 1 · TkA07G306560 · TK1151
Cytoplasm0.497
Rank 2 · TkA07G306560 · TK1151
Cell membrane0.079
Rank 3 · TkA07G306560 · TK1151
Endoplasmic reticulum0.061
Rank 4 · TkA07G306560 · TK1151
Mitochondrion0.051
Rank 5 · TkA07G306560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04872Pox_L523-36 aa
PF26832Phage_gp8625-52 aa
PF23548Zn_ribbon_FGT1_226-52 aa
PF23547Zn_ribbon_FGT1_126-57 aa
PF10122Zn_ribbon_Com27-36 aa
PF19134DUF581728-52 aa
PF06943zf-LSD129-53 aa
PF24868YABBY_N29-42 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G306560PF04872Pox_L523360.02515.2
TkA07G306560PF26832Phage_gp8625525.08.1
TkA07G306560PF23548Zn_ribbon_FGT1_226520.009916.2
TkA07G306560PF23547Zn_ribbon_FGT1_126570.04314.1
TkA07G306560PF10122Zn_ribbon_Com27367.46.8
TkA07G306560PF19134DUF581728521.59.6
TkA07G306560PF06943zf-LSD129532.3e-36124.0
TkA07G306560PF24868YABBY_N29420.0513.9
TkA07G306560PF02150Zn_ribbon_RPB929530.07713.6
TkA07G306560PF24868YABBY_N45750.0513.9
TkA07G306560PF23548Zn_ribbon_FGT1_264900.009916.2
TkA07G306560PF04872Pox_L565850.02515.2
TkA07G306560PF23547Zn_ribbon_FGT1_165910.04314.1
TkA07G306560PF10122Zn_ribbon_Com65937.46.8
TkA07G306560PF26832Phage_gp8666925.08.1
TkA07G306560PF19134DUF581767911.59.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q93ZB1Arabidopsis thalianasp|Q93ZB1|LOL1_ARATH Protein LOL176.800%Swiss-ProtHigh
P94077Arabidopsis thalianasp|P94077|LSD1_ARATH Protein LSD161.800%Swiss-ProtLow
Q0J7V9Oryza sativa subsp. japonicasp|Q0J7V9|LSD1_ORYSJ Protein LSD178.500%Swiss-ProtHigh
Q69UP7Oryza sativa subsp. japonicasp|Q69UP7|LOL1_ORYSJ Protein LOL176.300%Swiss-ProtLow
Q2QMB3Oryza sativa subsp. japonicasp|Q2QMB3|LOL2_ORYSJ Protein LOL259.500%Swiss-ProtLow

JBrowse

View in Genome Browser