TkA07G300830 | RubberDandelionOmics

Gene overview

TkA07G300830

Reference: TK1151 Chr: Chr07 Coordinates: 75614237-75614674 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

384 bp · TkA07G300830|TK1151|cDNA

ATGGCACAGACACCACAAAGTGCACCACCGGCACCCAAGGTCAGCACCAAATTCTCTGATGTGTTGGCGTTCAGTGGGCCTGCACCGGAGAGGATCAACGGAAGGCTGGCAATGATCGGGTTTGTGTCTGCCATGGCGGTGGAAGCAAGCAGCGGTCAGGACGTGTTTACCCAGATCGGCCATGGCGGAGTGGCGGTGTTTGTGGGGACCAGCGTACTCTTGTCAATAGCCTCGTTAGTGCCCTTGTTTAAAGGGGTGAC...

CDS

Download CDS FASTA

384 bp · TkA07G300830|TK1151|CDS

ATGGCACAGACACCACAAAGTGCACCACCGGCACCCAAGGTCAGCACCAAATTCTCTGATGTGTTGGCGTTCAGTGGGCCTGCACCGGAGAGGATCAACGGAAGGCTGGCAATGATCGGGTTTGTGTCTGCCATGGCGGTGGAAGCAAGCAGCGGTCAGGACGTGTTTACCCAGATCGGCCATGGCGGAGTGGCGGTGTTTGTGGGGACCAGCGTACTCTTGTCAATAGCCTCGTTAGTGCCCTTGTTTAAAGGGGTGAC...

Protein

Download Protein FASTA

127 aa · TkA07G300830|TK1151|PROTEIN

MAQTPQSAPPAPKVSTKFSDVLAFSGPAPERINGRLAMIGFVSAMAVEASSGQDVFTQIGHGGVAVFVGTSVLLSIASLVPLFKGVTVQSKSSGVMTSDAELWNGRFAMLGLVALAFTEYVTGSALV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G300830`
TK1151 ID	TkA07G300830
OH-1004 ID	LXL04_029314
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	86.200
Protein coverage (%)	TK1151 100.000 / OH-1004 85.294 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G300830

Location Chr07:75614237-75614674 (-)

Description Similar to ELIP1: Early light-induced protein 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g14690`	Probably involved in the integration of pigments into the mature light-harvesting pigment-protein complexes.	Mutational and expression analysis of ELIP1 and ELIP2 in Arabidopsis thaliana.2005 · DOI: 10.1007/s11103-005-4090-1 Suppression of both ELIP1 and ELIP2 in Arabidopsis does not affect tolerance to photoinhibition and photooxidative stress.2006 · DOI: 10.1104/pp.106.083055 The light stress-induced protein ELIP2 is a regulator of chlorophyll synthesis in Arabidopsis thaliana.2007 · DOI: 10.1111/j.1365-313x.2007.03090.x Inactivation of the ELIP1 and ELIP2 genes affects Arabidopsis seed germination.2011 · DOI: 10.1111/j.1469-8137.2010.03637.x
`At3g22840`	Prevents excess accumulation of free chlorophyll by inhibiting the entire chlorophyll biosynthesis pathway (e.g. 5-aminolevulinate synthesis and Mg-protoporphyrin IX chelatase activity), and hence prevent photooxidative stress (By similarity).	Early light-induced proteins protect Arabidopsis from photooxidative stress.2003 · DOI: 10.1073/pnas.0736939100 Mutational and expression analysis of ELIP1 and ELIP2 in Arabidopsis thaliana.2005 · DOI: 10.1007/s11103-005-4090-1 Suppression of both ELIP1 and ELIP2 in Arabidopsis does not affect tolerance to photoinhibition and photooxidative stress.2006 · DOI: 10.1104/pp.106.083055 Inactivation of the ELIP1 and ELIP2 genes affects Arabidopsis seed germination.2011 · DOI: 10.1111/j.1469-8137.2010.03637.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029314 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0010030 positive regulation of seed germination Biological Process

GO:0010114 response to red light Biological Process

GO:0010117 photoprotection Biological Process

GO:0010218 response to far red light Biological Process

GO:0010224 response to UV-B Biological Process

GO:0010380 regulation of chlorophyll biosynthetic process Biological Process

GO:0015979 photosynthesis Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0071483 cellular response to blue light Biological Process

GO:0071486 cellular response to high light intensity Biological Process

KEGG gene cross-reference

ath:AT3G22840

ath:AT4G14690

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.749

Rank 1 · TkA07G300830 · TK1151

Mitochondrion0.242

Rank 2 · TkA07G300830 · TK1151

Cytoplasm0.016

Rank 3 · TkA07G300830 · TK1151

Nucleus0.015

Rank 4 · TkA07G300830 · TK1151

Endoplasmic reticulum0.010

Rank 5 · TkA07G300830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00504Chloroa_b-bind28-81 aa

PF31213HliA29-56 aa

PF00504Chloroa_b-bind89-119 aa

PF31213HliA93-126 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G300830	`PF00504`	Chloroa_b-bind	28	81	2.6e-10	41.8
TkA07G300830	`PF31213`	HliA	29	56	1.1e-17	64.4
TkA07G300830	`PF00504`	Chloroa_b-bind	89	119	2.6e-10	41.8
TkA07G300830	`PF31213`	HliA	93	126	1.1e-17	64.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94K66`	Arabidopsis thaliana	sp\|Q94K66\|ELIP2_ARATH Early light-induced protein 2, chloroplastic	71.900%	Swiss-Prot	High
`P93735`	Arabidopsis thaliana	sp\|P93735\|ELIP1_ARATH Early light-induced protein 1, chloroplastic	75.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card