TkA07G297150 | RubberDandelionOmics

Gene overview

TkA07G297150

Reference: TK1151 Chr: Chr07 Coordinates: 74614934-74627801 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3351 bp · TkA07G297150|TK1151|cDNA

AGATTATCTAAATGCCCTGTCTCTCTTGAACTACACAAATTAATCATAATCGGCGCAAAAACGGAAAAGAGAAACCTTGGTTTTCCCTCTCCCTCTCCCTCTCCCTCTCCGACGAACTGCTGCCAATCAAAGGGCTTCACAGTCGTTTTTACTCTCCATCGTATTCAGCTTCCATCGCTTCTGTATCATATGACTAATTTTGGTCTCGACCCCTAAAATGAACCTGTGATTGGGAAGGAACAATCGACAAACAGGACCTG...

CDS

Download CDS FASTA

2703 bp · TkA07G297150|TK1151|CDS

ATGAGTCGAATAGAGAGGCTCTTGAGGGAAAGAGAGCTAAGAAAGAACAATAAAGCTTCCCATTCCAATGAATATATTGATCTTGAACCACGAGATGGATCCGAAGCTGATGGCAATATGGAAAAATATCTCAAAAAAGACTCTTCAGCAAGTGATGGGTGGGAAAAACATGATGAAGGTCTGTTTAAAGAAAGGCTATTAGTCGTTGCTAATAGACTTCCGGTCTCTGCCGTTAGGACAGGTGAAGAGAGTTGGTCACT...

Protein

Download Protein FASTA

900 aa · TkA07G297150|TK1151|PROTEIN

MSRIERLLRERELRKNNKASHSNEYIDLEPRDGSEADGNMEKYLKKDSSASDGWEKHDEGLFKERLLVVANRLPVSAVRTGEESWSLEVRDGEHVTALLDVKEIEVKWIGWIGLHVPDELGQSSLIKALYQERCIPVFLDEETIHQYYNGYCNNILWPLFHYLGLPQEDRLATTRTYESQFSAYKKANQMFADVVNLNYEEGDAVWCHDYHLMFLPKCLKDYNKNMKVGWFLHTPFPSSEIHRTLPSRSELLRAVLAADL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G297150`
TK1151 ID	TkA07G297150
OH-1004 ID	LXL04_029288
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G297150

Location Chr07:74614934-74627801 (-)

Description Similar to TPS1: Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g78580`	Required for normal embryo development, vegetative growth and transition to flowering.	Trehalose metabolism in Arabidopsis: occurrence of trehalose and molecular cloning and characterization of trehalose-6-phosphate synthase homologues.2001 · DOI: 10.1093/jexbot/52.362.1817 Trehalose-6-phosphate synthase 1, which catalyses the first step in trehalose synthesis, is essential for Arabidopsis embryo maturation.2002 · DOI: 10.1046/j.1365-313x.2002.01220.x Truncation of Arabidopsis thaliana and Selaginella lepidophylla trehalose-6-phosphate synthase unlocks high catalytic activity and supports high trehalose levels on expression in yeast.2002 · DOI: 10.1042/bj20020517 Trehalose 6-phosphate is indispensable for carbohydrate utilization and growth in Arabidopsis thaliana.2003 · DOI: 10.1073/pnas.1132018100 Arabidopsis trehalose-6-phosphate synthase 1 is essential for normal vegetative growth and transition to flowering.2004 · DOI: 10.1104/pp.104.039743 Trehalose metabolism and glucose sensing in plants.2005 · DOI: 10.1042/bst0330276 The role of trehalose-6-phosphate synthase in Arabidopsis embryo development.2005 · DOI: 10.1042/bst0330280 Delayed embryo development in the ARABIDOPSIS TREHALOSE-6-PHOSPHATE SYNTHASE 1 mutant is associated with altered cell wall structure, decreased cell division and starch accumulation.2006 · DOI: 10.1111/j.1365-313x.2006.02662.x Isolation and molecular characterization of the Arabidopsis TPS1 gene, encoding trehalose-6-phosphate synthase.1998 · DOI: 10.1046/j.1365-313x.1998.00063.x
`At1g16980`	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 2.	No verified direct reference in this release
`At4g27550`	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 4.	No verified direct reference in this release
`At1g17000`	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029288 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005991 trehalose metabolic process Biological Process

GO:0005992 trehalose biosynthetic process Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0010182 sugar mediated signaling pathway Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0048364 root development Biological Process

GO:0048574 long-day photoperiodism, flowering Biological Process

GO:0051301 cell division Biological Process

GO:0080186 developmental vegetative growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G16980

ath:AT1G17000

ath:AT1G78580

ath:AT4G27550

ddi:DDB_G0287657

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.572

Rank 1 · TkA07G297150 · TK1151

Nucleus0.281

Rank 2 · TkA07G297150 · TK1151

Cell membrane0.105

Rank 3 · TkA07G297150 · TK1151

Golgi apparatus0.082

Rank 4 · TkA07G297150 · TK1151

Lysosome / Vacuole0.077

Rank 5 · TkA07G297150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00982Glyco_transf_2065-530 aa

PF20603Bact_hydrolase174-229 aa

PF22776K_trans_C354-404 aa

PF20603Bact_hydrolase481-505 aa

PF02358Trehalose_PPase587-784 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G297150	`PF00982`	Glyco_transf_20	65	530	2.7e-177	591.0
TkA07G297150	`PF20603`	Bact_hydrolase	174	229	0.78	10.3
TkA07G297150	`PF22776`	K_trans_C	354	404	0.073	13.6
TkA07G297150	`PF20603`	Bact_hydrolase	481	505	0.78	10.3
TkA07G297150	`PF02358`	Trehalose_PPase	587	784	2.4e-55	187.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SYM4`	Arabidopsis thaliana	sp\|Q9SYM4\|TPS1_ARATH Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1	68.600%	Swiss-Prot	High
`Q9FZ57`	Arabidopsis thaliana	sp\|Q9FZ57\|TPS2_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 2	62.800%	Swiss-Prot	High
`Q9T079`	Arabidopsis thaliana	sp\|Q9T079\|TPS4_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 4	57.000%	Swiss-Prot	High
`Q9SHG0`	Arabidopsis thaliana	sp\|Q9SHG0\|TPS3_ARATH Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 3	55.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card