TkA07G293260 | RubberDandelionOmics

Gene overview

TkA07G293260

Reference: TK1151 Chr: Chr07 Coordinates: 73527145-73528761 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

953 bp · TkA07G293260|TK1151|cDNA

TTCTATTTTACCTGTCATTATCATTTGTTGACTTAAAATATTTTTTGGGAGCAATAGATTACAGTCTTCGTTTCTCCGTATTCCGTCTCATAAGCAAACCCTAGCCCCTCTCTTCCGAAGAAACGCCACAGCTTCCAATTCGATAATGGTGTGTATACGCAAGGCGACCATAGACGACCTGCTTGCGATGCAAGCATGCAACCTCTTCTGTCTTCCTGAAAACTACCAGATGAAATACTATTTCTACCACATTCTCTCTT...

CDS

Download CDS FASTA

540 bp · TkA07G293260|TK1151|CDS

ATGGTGTGTATACGCAAGGCGACCATAGACGACCTGCTTGCGATGCAAGCATGCAACCTCTTCTGTCTTCCTGAAAACTACCAGATGAAATACTATTTCTACCACATTCTCTCTTGGCCCCAGCTCCTCTACGTCGCAGAGGATTATGGCGGCAAGATCGTCGGTTATGTGCTTGCTAAGATGGAAGAAGAGACCACCGAGTGTCACGGACACATCACGTCACTCGCTGTTCTCCGTACGCATCGTAAGTTAGGGCTTGC...

Protein

Download Protein FASTA

179 aa · TkA07G293260|TK1151|PROTEIN

MVCIRKATIDDLLAMQACNLFCLPENYQMKYYFYHILSWPQLLYVAEDYGGKIVGYVLAKMEEETTECHGHITSLAVLRTHRKLGLATKLMAAAQNAMEQVFGAEYVSLHVRKSNRAAFNLYTETLGYKIHDMEAKYYADGEDAYDMRKELKGKSLHQNHHHHHHHHGGGCCSGDAKAE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G293260`
TK1151 ID	TkA07G293260
OH-1004 ID	LXL04_005983
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	87.200
Protein coverage (%)	TK1151 100.000 / OH-1004 85.294 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G293260

Location Chr07:73527145-73528761 (+)

Description Similar to NAA10: N-terminal acetyltransferase A complex catalytic subunit NAA10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13780`	Catalytic subunit of the NatA N-alpha-acetyltransferase complex.	Protein N-terminal acetylation is required for embryogenesis in Arabidopsis.2016 · DOI: 10.1093/jxb/erw257 NatA is required for suspensor development in Arabidopsis.2016 · DOI: 10.1080/15592324.2016.1231293

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005983 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006474 N-terminal protein amino acid acetylation Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0051604 protein maturation Biological Process

GO:1904592 positive regulation of protein refolding Biological Process

GO:2000719 negative regulation of maintenance of mitotic sister chromatid cohesion, centromeric Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005813 centrosome Cellular Component

KEGG gene cross-reference

ath:AT5G13780

bta:613636

hsa:8260

mmu:56292

mmu:97243

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.602

Rank 1 · TkA07G293260 · TK1151

Nucleus0.552

Rank 2 · TkA07G293260 · TK1151

Cell membrane0.133

Rank 3 · TkA07G293260 · TK1151

Mitochondrion0.076

Rank 4 · TkA07G293260 · TK1151

Endoplasmic reticulum0.050

Rank 5 · TkA07G293260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00583Acetyltransf_121-128 aa

PF13420Acetyltransf_441-147 aa

PF13508Acetyltransf_742-129 aa

PF13673Acetyltransf_1043-151 aa

PF13302Acetyltransf_351-122 aa

PF13527Acetyltransf_963-109 aa

PF08445FR4768-131 aa

PF17013Acetyltransf_1572-123 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G293260	`PF00583`	Acetyltransf_1	21	128	1.2e-19	71.4
TkA07G293260	`PF13420`	Acetyltransf_4	41	147	0.0025	18.6
TkA07G293260	`PF13508`	Acetyltransf_7	42	129	9.1e-11	42.7
TkA07G293260	`PF13673`	Acetyltransf_10	43	151	1.6e-10	41.8
TkA07G293260	`PF13302`	Acetyltransf_3	51	122	0.051	15.0
TkA07G293260	`PF13527`	Acetyltransf_9	63	109	0.026	15.2
TkA07G293260	`PF08445`	FR47	68	131	3.6e-06	27.6
TkA07G293260	`PF17013`	Acetyltransf_15	72	123	0.055	13.6
TkA07G293260	`PF01454`	MAGE	77	124	0.23	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKI4`	Arabidopsis thaliana	sp\|Q9FKI4\|NAA10_ARATH N-terminal acetyltransferase A complex catalytic subunit NAA10	88.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card