TkA07G292850 | RubberDandelionOmics

Gene overview

TkA07G292850

Reference: TK1151 Chr: Chr07 Coordinates: 73421308-73425231 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1689 bp · TkA07G292850|TK1151|cDNA

GCCATTATCACTGCGAGTAGCTATCGCCTTCTTTTAGTACTAGCTTTCCGAGTGAGAACAATTCTCGGCAATTTGTTCTTGTTTTTCACGATTTGCCTTCACTTTCCCTAGTTCACAAGTCACAGCTACAGCATCATCGTTTGCATTTTTTTCTCGTATCTCACAGTATGATTGAAAAAGCATGTGGATGGCTATGTGTGATACTGGTGTGTTTACTTCAACTACTGGATACATATGGTTTCTATGTTGATATTACTTAT...

CDS

Download CDS FASTA

1182 bp · TkA07G292850|TK1151|CDS

ATGATTGAAAAAGCATGTGGATGGCTATGTGTGATACTGGTGTGTTTACTTCAACTACTGGATACATATGGTTTCTATGTTGATATTACTTATCTCGAATGTGCAGTGGAAAAAGGAGCAGTTTGTTTGGATGGAAGCCCACCTGCATACCATTGGGACATGGGATTTGATACAGGAATGGACAACTGGTTAGTACACATTGAGGGAGGAGGATGGTGCAACAATGTCACAACTTGTCTTGATCGCACAAAAACCCGTCT...

Protein

Download Protein FASTA

393 aa · TkA07G292850|TK1151|PROTEIN

MIEKACGWLCVILVCLLQLLDTYGFYVDITYLECAVEKGAVCLDGSPPAYHWDMGFDTGMDNWLVHIEGGGWCNNVTTCLDRTKTRLGSSKQMAEQVAFSGILHNEQQYNPDFYNWNKIKVRYCDGASFTGDVEKVNPKTNLHFRGARIFHAVIDDLLAKGMSNAENAILSGCSAGGLASILHCDKFKSLLPKTANVKCLSDAGYFINSQDVSGKRRLEAFYDDVVKTHGSAKHLPRSCTSKMKSSLCFFPENMVRKVLT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G292850`
TK1151 ID	TkA07G292850
OH-1004 ID	LXL04_029363
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.500
Protein coverage (%)	TK1151 100.000 / OH-1004 95.620 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G292850

Location Chr07:73421308-73425231 (+)

Description Similar to PAE8: Pectin acetylesterase 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g19420`	Hydrolyzes acetyl esters in homogalacturonan regions of pectin.	Identification and functional characterization of the distinct plant pectin esterases PAE8 and PAE9 and their deletion mutants.2014 · DOI: 10.1007/s00425-014-2139-6
`At4g19410`	Hydrolyzes acetyl esters in homogalacturonan regions of pectin.	No verified direct reference in this release
`At5g45280`	Hydrolyzes acetyl esters in homogalacturonan regions of pectin.	No verified direct reference in this release
`At5g26670`	Hydrolyzes acetyl esters in homogalacturonan regions of pectin.	No verified direct reference in this release
`At3g62060`	Hydrolyzes acetyl esters in homogalacturonan regions of pectin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029363 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009625 response to insect Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0052793 pectin acetylesterase activity Molecular Function

KEGG gene cross-reference

ath:AT3G05910

ath:AT4G19410

ath:AT4G19420

ath:AT5G26670

ath:AT5G45280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.443

Rank 1 · TkA07G292850 · TK1151

Extracellular0.312

Rank 2 · TkA07G292850 · TK1151

Cytoplasm0.114

Rank 3 · TkA07G292850 · TK1151

Cell membrane0.106

Rank 4 · TkA07G292850 · TK1151

Golgi apparatus0.088

Rank 5 · TkA07G292850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03283PAE25-388 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G292850	`PF03283`	PAE	25	388	1.6e-172	574.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6DBP4`	Arabidopsis thaliana	sp\|Q6DBP4\|PAE8_ARATH Pectin acetylesterase 8	63.500%	Swiss-Prot	High
`Q940J8`	Arabidopsis thaliana	sp\|Q940J8\|PAE7_ARATH Pectin acetylesterase 7	59.700%	Swiss-Prot	High
`Q9FH82`	Arabidopsis thaliana	sp\|Q9FH82\|PAE11_ARATH Pectin acetylesterase 11	58.000%	Swiss-Prot	High
`Q66GM8`	Arabidopsis thaliana	sp\|Q66GM8\|PAE10_ARATH Pectin acetylesterase 10	51.400%	Swiss-Prot	High
`Q84JS1`	Arabidopsis thaliana	sp\|Q84JS1\|PAE6_ARATH Pectin acetylesterase 6	52.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card