RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G291590
Reference: TK1151 Chr: Chr07 Coordinates: 73142781-73149521 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1383 bp · TkA07G291590|TK1151|cDNA

ATGGGAGCCGGTAAATCCAGTCTCGTATTGCGGTTCGTCAAAGGCCAATTTCTGGAATTCCAGGAATCCACCATCGGTGCAGTCTTCTTTTCACAAACTTCAGCGGTAAACGACGCCACTGTGAAATTTGAGATTTGGGATACGGCGGGTCAAGAAATCAAGATCACATACGAGGGCCGACCTGTTATTGCTGTTGGTGTAGGGCTTAGCACATATGACAAAGCATCTATTCATTCATATGTTCAATCACACATCCAGAT...

CDS

Download CDS FASTA

1383 bp · TkA07G291590|TK1151|CDS

ATGGGAGCCGGTAAATCCAGTCTCGTATTGCGGTTCGTCAAAGGCCAATTTCTGGAATTCCAGGAATCCACCATCGGTGCAGTCTTCTTTTCACAAACTTCAGCGGTAAACGACGCCACTGTGAAATTTGAGATTTGGGATACGGCGGGTCAAGAAATCAAGATCACATACGAGGGCCGACCTGTTATTGCTGTTGGTGTAGGGCTTAGCACATATGACAAAGCATCTATTCATTCATATGTTCAATCACACATCCAGAT...

Protein

Download Protein FASTA

460 aa · TkA07G291590|TK1151|PROTEIN

MGAGKSSLVLRFVKGQFLEFQESTIGAVFFSQTSAVNDATVKFEIWDTAGQEIKITYEGRPVIAVGVGLSTYDKASIHSYVQSHIQINEFRDCVIMPSATKKYERQISTCVKVLDMTGLRLSHLNQIKLLTVISSIDDLNYPEKTDTYYIVNAPYVFSACWKVVKPLLQERTRKKVQVLSGCGKDDLLKCYRKDKAEQATLTQSTNISAQDFKYSICPWFTEKRKHKKESKKMWVNKKAFPEPKRMKQVWVVKNTCAQPE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G291590
TK1151 IDTkA07G291590
OH-1004 IDLXL04_003890
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)98.900
Protein coverage (%)TK1151 41.087 / OH-1004 99.474
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G291590
LocationChr07:73142781-73149521 (+)
DescriptionSimilar to RHN1: Ras-related protein RHN1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g45130 Involved in the trafficking of soluble cargo proteins from the prevacuolar compartment to the central vacuole. No verified direct reference in this release
At4g19640 Endosomal protein that may be involved in endocytosis.
ARA7(Q69L) expression in transgenic Arabidopsis cells induces the formation of enlarged multivesicular bodies.2013 · DOI: 10.1093/jxb/ert125

Rice

Reference gene IDPossible functionPapers / DOI
Os12g0631100 Plays an important role in intracellular trafficking of seed storage proteins to the protein storage vacuoles (PSVs).
OsRab5a regulates endomembrane organization and storage protein trafficking in rice endosperm cells.2010 · DOI: 10.1111/j.1365-313x.2010.04370.x
The small GTPase Rab5a is essential for intracellular transport of proglutelin from the Golgi apparatus to the protein storage vacuole and endosomal membrane organization in developing rice endosperm.2011 · DOI: 10.1104/pp.111.180505
OsVPS9A functions cooperatively with OsRAB5A to regulate post-Golgi dense vesicle-mediated storage protein trafficking to the protein storage vacuole in rice endosperm cells.2013 · DOI: 10.1093/mp/sst081
Zipcode RNA-Binding Proteins and Membrane Trafficking Proteins Cooperate to Transport Glutelin mRNAs in Rice Endosperm.2020 · DOI: 10.1105/tpc.20.00111
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_003890 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006886 intracellular protein transport Biological Process
GO:0007033 vacuole organization Biological Process
GO:0007034 vacuolar transport Biological Process
GO:0010256 endomembrane system organization Biological Process
GO:0015031 protein transport Biological Process
GO:0045324 late endosome to vacuole transport Biological Process
GO:0051028 mRNA transport Biological Process
GO:0000139 Golgi membrane Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005768 endosome Cellular Component
GO:0005769 early endosome Cellular Component
GO:0005774 vacuolar membrane Cellular Component
KEGG gene cross-reference
ath:AT4G19640
ath:AT5G45130
dosa:Os12g0631100
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.548
Rank 1 · TkA07G291590 · TK1151
Nucleus0.294
Rank 2 · TkA07G291590 · TK1151
Mitochondrion0.132
Rank 3 · TkA07G291590 · TK1151
Cell membrane0.114
Rank 4 · TkA07G291590 · TK1151
Endoplasmic reticulum0.089
Rank 5 · TkA07G291590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00071Ras2-52 aa
PF08477Roc2-53 aa
PF00025Arf2-52 aa
PF00650CRAL_TRIO57-195 aa
PF26251TPR_TRAPPC9-Trs12072-136 aa
PF13716CRAL_TRIO_2110-180 aa
PF00025Arf159-212 aa
PF00071Ras180-197 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G291590PF00071Ras2521.7e-1454.4
TkA07G291590PF08477Roc2533.4e-1144.1
TkA07G291590PF00025Arf2520.01115.9
TkA07G291590PF00650CRAL_TRIO571951.4e-1867.9
TkA07G291590PF26251TPR_TRAPPC9-Trs120721360.08912.9
TkA07G291590PF13716CRAL_TRIO_21101800.005417.8
TkA07G291590PF00025Arf1592120.01115.9
TkA07G291590PF00071Ras1801971.7e-1454.4
TkA07G291590PF08477Roc2152373.4e-1144.1
TkA07G291590PF13716CRAL_TRIO_22332680.005417.8
TkA07G291590PF03263Cucumo_2B2633070.01316.6
TkA07G291590PF08477Roc2692833.4e-1144.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
P31582Arabidopsis thalianasp|P31582|RAF2A_ARATH Ras-related protein RABF2a90.400%Swiss-ProtLow
Q9SN68Arabidopsis thalianasp|Q9SN68|RAF2B_ARATH Ras-related protein RABF2b90.400%Swiss-ProtLow
Q0ILQ6Oryza sativa subsp. japonicasp|Q0ILQ6|RAB5A_ORYSJ Ras-related protein Rab5A54.900%Swiss-ProtLow

JBrowse

View in Genome Browser