TkA07G284630 | RubberDandelionOmics

Gene overview

TkA07G284630

Reference: TK1151 Chr: Chr07 Coordinates: 71397140-71412923 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4080 bp · TkA07G284630|TK1151|cDNA

AGAAAACTTAGTAAGAGAAAGTTAGAGCGACATATATACGTGTGTAGAGAGAGAGAGTAGAAAGCAGGACGTGTTGTGTTGCGGTTTTTGCAGAAAGACTGAGGAAGTTTGCTGTTGTCGAAGAAACCCTAACTTTGAACTTTTTTGGCTCACAAAAAAGCAGTACTGAGGAGAATACTGGAAACAAAAAACGCAATCTTCTTGTAGATTGTCAAAGGCTTCACGAAGATATTTGGTTGAAGATGCTGATGCTATAAATT...

CDS

Download CDS FASTA

3405 bp · TkA07G284630|TK1151|CDS

ATGTCATCCTTAAGTCGGGAACTAGTTTTCCTAATCCTGCAATTCCTGGATGAGGAAAAGTTCAAGGAAACTGTCCACAAGCTGGAACAAGAATCGGCTTTTTTCTTCAATATGAAGTATTTTGAGGAACAAGTTCAAGCTGGTGAATGGGATGAGGTTGAAAAGTATCTATGTGGGTTCACTAAGGTTGAAGACAATCGGTACTCAATGAAGATATTCTTTGAAATAAGGAAACAGAAGTACCTTGAAGCTCTTGATAG...

Protein

Download Protein FASTA

1134 aa · TkA07G284630|TK1151|PROTEIN

MSSLSRELVFLILQFLDEEKFKETVHKLEQESAFFFNMKYFEEQVQAGEWDEVEKYLCGFTKVEDNRYSMKIFFEIRKQKYLEALDRNDRAKAVEILVKDLKVFSTFNEELFKEITQLLTLDNFRQNEQLSKYGDTKSARSIMLVELKKLIEANPLFREKLTLPVFKASRLRTLINQSLNWQHQLCKNPRPNPDIKTLFIDHTCASNNGGRAPPPINSSLSGPVPKAGVFPPIGAHGPFQPVVSPSAGWMATANLSMPHA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G284630`
TK1151 ID	TkA07G284630
OH-1004 ID	LXL04_029204
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.400
Protein coverage (%)	TK1151 99.471 / OH-1004 55.848 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G284630

Location Chr07:71397140-71412923 (+)

Description Similar to TPR2: Protein TOPLESS-RELATED PROTEIN 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g15750`	Transcriptional corepressor.	No verified direct reference in this release
`At1g80490`	Transcriptional corepressor.	Arabidopsis resistance protein SNC1 activates immune responses through association with a transcriptional corepressor.2010 · DOI: 10.1073/pnas.1002828107
`At3g15880`	Transcription corepressor of Zinc finger transcription factors GAF1/IDD2 and ENY/IDD1 in regulation of gibberellin homeostasis and signaling.	No verified direct reference in this release
`At5g27030`	Transcriptional corepressor.	No verified direct reference in this release
`At3g16830`	Transcriptional corepressor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0162100`	Transcriptional corepressor involved in branch formation regulation, presumably by suppressing primary branch formation and promoting secondary branch formation.	OsLIS-L1 encoding a lissencephaly type-1-like protein with WD40 repeats is required for plant height and male gametophyte formation in rice.2012 · DOI: 10.1007/s00425-011-1532-7
`Os03g0254700`	Probable downstream regulator of strigolactones signaling (By similarity).	MODD Mediates Deactivation and Degradation of OsbZIP46 to Negatively Regulate ABA Signaling and Drought Resistance in Rice.2016 · DOI: 10.1105/tpc.16.00171
`Os01g0254100`	Probable downstream regulator of strigolactones signaling.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029204 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009733 response to auxin Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0010072 primary shoot apical meristem specification Biological Process

GO:0010229 inflorescence development Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0042802 identical protein binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT1G15750

dosa:Os08g0162100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.531

Rank 1 · TkA07G284630 · TK1151

Cytoplasm0.381

Rank 2 · TkA07G284630 · TK1151

Lysosome / Vacuole0.086

Rank 3 · TkA07G284630 · TK1151

Cell membrane0.078

Rank 4 · TkA07G284630 · TK1151

Golgi apparatus0.058

Rank 5 · TkA07G284630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25437BRWD1_N3-31 aa

PF17814LisH_TPL5-33 aa

PF21889TPR1-like_2nd37-161 aa

PF10607CTLH69-135 aa

PF21359zf_topless164-204 aa

PF24814WD40_Prp19333-377 aa

PF23414Beta-prop_EML_2333-462 aa

PF25171Beta-prop_WDR36-Utp21_1st333-378 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G284630	`PF25437`	BRWD1_N	3	31	0.069	14.1
TkA07G284630	`PF17814`	LisH_TPL	5	33	4.4e-12	46.2
TkA07G284630	`PF21889`	TPR1-like_2nd	37	161	1.2e-62	210.5
TkA07G284630	`PF10607`	CTLH	69	135	0.0066	17.3
TkA07G284630	`PF21359`	zf_topless	164	204	1.9e-25	88.9
TkA07G284630	`PF24814`	WD40_Prp19	333	377	9.7e-42	143.7
TkA07G284630	`PF23414`	Beta-prop_EML_2	333	462	3.1e-35	122.5
TkA07G284630	`PF25171`	Beta-prop_WDR36-Utp21_1st	333	378	3.8e-22	79.7
TkA07G284630	`PF24805`	EIF3I	334	379	3.2e-15	56.8
TkA07G284630	`PF23419`	WD40_RFWD3	334	380	0.00044	20.4
TkA07G284630	`PF24817`	WD40_WDHD1_1st	335	436	1.9e-39	136.3
TkA07G284630	`PF24807`	WD40_CDC20-Fz	335	378	8.5e-32	111.3
TkA07G284630	`PF08662`	eIF2A	335	379	0.00019	22.1
TkA07G284630	`PF25175`	Beta-prop_WDR5	337	378	2e-43	149.5
TkA07G284630	`PF23381`	Beta-prop_IFT122_1st	340	377	1.3e-39	136.9
TkA07G284630	`PF25174`	Beta-prop_THOC3	340	376	7.4e-39	134.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94AI7`	Arabidopsis thaliana	sp\|Q94AI7\|TPL_ARATH Protein TOPLESS	66.000%	Swiss-Prot	High
`Q0WV90`	Arabidopsis thaliana	sp\|Q0WV90\|TPR1_ARATH Topless-related protein 1	65.700%	Swiss-Prot	High
`Q27GK7`	Arabidopsis thaliana	sp\|Q27GK7\|TPR4_ARATH Topless-related protein 4	63.400%	Swiss-Prot	High
`Q84JM4`	Arabidopsis thaliana	sp\|Q84JM4\|TPR3_ARATH Topless-related protein 3	34.400%	Swiss-Prot	Medium
`Q9LRZ0`	Arabidopsis thaliana	sp\|Q9LRZ0\|TPR2_ARATH Topless-related protein 2	84.500%	Swiss-Prot	Low
`Q0J7U6`	Oryza sativa subsp. japonica	sp\|Q0J7U6\|TPR2_ORYSJ Protein TOPLESS-RELATED PROTEIN 2	75.400%	Swiss-Prot	High
`Q10NY2`	Oryza sativa subsp. japonica	sp\|Q10NY2\|TPR3_ORYSJ Protein TPR3	65.200%	Swiss-Prot	High
`Q5NBT9`	Oryza sativa subsp. japonica	sp\|Q5NBT9\|TPR1_ORYSJ Protein TPR1	87.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card