TkA07G280470 | RubberDandelionOmics

Gene overview

TkA07G280470

Reference: TK1151 Chr: Chr07 Coordinates: 70133609-70134726 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

783 bp · TkA07G280470|TK1151|cDNA

ATGAATCGTCACCACAACGGTGGTATTGGTCGATTACGGTTTGCCGGAAAACCAATCGGTGCTGTTGGTTTTCTCTTGATGGATCCATCGCCAAACACTCAATCCGCGACGGCTAAACCACAAGAAGATGCTGAATTCTGGCCATTATCTGGGAAACCTTATTTCTATGTGGTTCTTAGCAAATTACACCTTGCAACCAGGTTTCAATTGGCCTTCCCACGTAAACTGAGTGAAAAACTTCCTGCTGCTATGGTGTCTGC...

CDS

Download CDS FASTA

525 bp · TkA07G280470|TK1151|CDS

ATGAATCGTCACCACAACGGTGGTATTGGTCGATTACGGTTTGCCGGAAAACCAATCGGTGCTGTTGGTTTTCTCTTGATGGATCCATCGCCAAACACTCAATCCGCGACGGCTAAACCACAAGAAGATGCTGAATTCTGGCCATTATCTGGGAAACCTTATTTCTATGTGGTTCTTAGCAAATTACACCTTGCAACCAGGTTTCAATTGGCCTTCCCACGTAAACTGAGTGAAAAACTTCCTGCTGCTATGGTGTCTGC...

Protein

Download Protein FASTA

174 aa · TkA07G280470|TK1151|PROTEIN

MNRHHNGGIGRLRFAGKPIGAVGFLLMDPSPNTQSATAKPQEDAEFWPLSGKPYFYVVLSKLHLATRFQLAFPRKLSEKLPAAMVSAKIVCKGKVWDLVYIGDQGTKKFENQTWGKFVMDNNLAVGDVCVFELMEAGFNGGTVKFKVQILRDDFPSELVEKAEGNNMNNPIDID

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G280470`
TK1151 ID	TkA07G280470
OH-1004 ID	LXL04_029157
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	96.100
Protein coverage (%)	TK1151 87.356 / OH-1004 77.949 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G280470

Location Chr07:70133609-70134726 (-)

Description Similar to Os04g0386900: B3 domain-containing protein Os04g0386900

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0386900`	B3 domain-containing protein Os04g0386900.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029157 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

dosa:Os04g0386900

dosa:Os06g0112300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.952

Rank 1 · TkA07G280470 · TK1151

Cytoplasm0.082

Rank 2 · TkA07G280470 · TK1151

Cell membrane0.022

Rank 3 · TkA07G280470 · TK1151

Endoplasmic reticulum0.018

Rank 4 · TkA07G280470 · TK1151

Extracellular0.010

Rank 5 · TkA07G280470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04591DUF59635-53 aa

PF02362B355-139 aa

PF04591DUF59665-81 aa

PF04591DUF596138-163 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G280470	`PF04591`	DUF596	35	53	0.22	12.6
TkA07G280470	`PF02362`	B3	55	139	3.9e-10	40.3
TkA07G280470	`PF04591`	DUF596	65	81	0.22	12.6
TkA07G280470	`PF04591`	DUF596	138	163	0.22	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7XLP4`	Oryza sativa subsp. japonica	sp\|Q7XLP4\|Y4869_ORYSJ B3 domain-containing protein Os04g0386900	36.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card