TkA07G271670 | RubberDandelionOmics

Gene overview

TkA07G271670

Reference: TK1151 Chr: Chr07 Coordinates: 67916925-67919240 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

915 bp · TkA07G271670|TK1151|cDNA

ATGGTGGAAGAAATGACATATAATAATGTCCCCCCGCGTGACATTCTTTCGACCTTGAAGAGTCAAAATGAACATAACGTAAGCACAATAGACACCATTTATAATGCACGAGAAAAACATCGATCAAAAATGCATGCAGGTAGAAGCGACATGCAAGTTGTATTCGAAATTTTGCAATCAAAAGGCTATATATATGAGTTTCGAACAGATGAAACGACCAATGCATTGAAAGACTTGTTTTTTGTTCATCCGACATCATT...

CDS

Download CDS FASTA

915 bp · TkA07G271670|TK1151|CDS

ATGGTGGAAGAAATGACATATAATAATGTCCCCCCGCGTGACATTCTTTCGACCTTGAAGAGTCAAAATGAACATAACGTAAGCACAATAGACACCATTTATAATGCACGAGAAAAACATCGATCAAAAATGCATGCAGGTAGAAGCGACATGCAAGTTGTATTCGAAATTTTGCAATCAAAAGGCTATATATATGAGTTTCGAACAGATGAAACGACCAATGCATTGAAAGACTTGTTTTTTGTTCATCCGACATCATT...

Protein

Download Protein FASTA

304 aa · TkA07G271670|TK1151|PROTEIN

MVEEMTYNNVPPRDILSTLKSQNEHNVSTIDTIYNAREKHRSKMHAGRSDMQVVFEILQSKGYIYEFRTDETTNALKDLFFVHPTSLNIWRAFPQVLMMDATYKTNKYNMHFLEIVGESERHNTYSFGASSMINEHALMNEIPSEFQAYVSHIQNVDGDGHCGFRDDINSISEALNYYGTPAIRKYWMIMPETGILIANKYGVIVHFLSKDGSSTCFPLRSGPQDFANHPIINIALTNRCHYVKVDLQEGHPLANVSWLW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G271670`
TK1151 ID	TkA07G271670
OH-1004 ID	LXL04_030089
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	51.100
Protein coverage (%)	TK1151 88.816 / OH-1004 72.973 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G271670`
Location	Chr07:67916925-67919240 (-)
Description	Similar to CHGG_01239: PKS-NRPS hybrid synthetase CHGG_01239 (Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_030089` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006633 fatty acid biosynthetic process Biological Process GO:0009403 toxin biosynthetic process Biological Process GO:0032259 methylation Biological Process GO:0005634 nucleus Cellular Component GO:0009506 plasmodesma Cellular Component GO:0004312 fatty acid synthase activity Molecular Function GO:0004315 3-oxoacyl-[acyl-carrier-protein] synthase activity Molecular Function GO:0008168 methyltransferase activity Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0016491 oxidoreductase activity Molecular Function GO:0016853 isomerase activity Molecular Function
KEGG gene cross-reference	ath:AT1G52520 ath:AT2G27110 ath:AT2G32250 ath:AT4G38180 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.816

Rank 1 · TkA07G271670 · TK1151

Cytoplasm0.308

Rank 2 · TkA07G271670 · TK1151

Extracellular0.022

Rank 3 · TkA07G271670 · TK1151

Mitochondrion0.018

Rank 4 · TkA07G271670 · TK1151

Cell membrane0.017

Rank 5 · TkA07G271670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07530PRE_C2HC15-45 aa

PF00410Ribosomal_S830-75 aa

PF10008DUF225143-83 aa

PF26338DUF808850-66 aa

PF21056ZSWIM1-3_RNaseH-like59-156 aa

PF10551MULE96-139 aa

PF07530PRE_C2HC99-123 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G271670	`PF07530`	PRE_C2HC	15	45	0.11	13.3
TkA07G271670	`PF00410`	Ribosomal_S8	30	75	0.0075	17.0
TkA07G271670	`PF10008`	DUF2251	43	83	0.18	12.2
TkA07G271670	`PF26338`	DUF8088	50	66	0.14	12.7
TkA07G271670	`PF21056`	ZSWIM1-3_RNaseH-like	59	156	2.2e-08	34.8
TkA07G271670	`PF10551`	MULE	96	139	1.1e-06	29.6
TkA07G271670	`PF07530`	PRE_C2HC	99	123	0.11	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card