TkA07G269960 | RubberDandelionOmics

Gene overview

TkA07G269960

Reference: TK1151 Chr: Chr07 Coordinates: 67495123-67497363 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1787 bp · TkA07G269960|TK1151|cDNA

GAAAGCCGCAACTGGCATTCTATATTAAGACCGTGCATAAGTTTCTTGCTGATGGAATCTCATTGTTGGGTCTGGTGTTACTCAATGATGTCTGAATGTTTCGTATTAAAGAAGAAGCCTAGGGCTTGGATTTTTCGTATTTCAAAATTTAAAGATGAATTGGTTTTTTAGTTGCTCCAATTCCAAAGACGACGAAACTGATTTGAGAGTCAATCTTCTTGCAGCTCATGAAAAGGGAGAAACATGCGACGATGTTACAA...

CDS

Download CDS FASTA

987 bp · TkA07G269960|TK1151|CDS

ATGAATTGGTTTTTTAGTTGCTCCAATTCCAAAGACGACGAAACTGATTTGAGAGTCAATCTTCTTGCAGCTCATGAAAAGGGAGAAACATGCGACGATGTTACAAAGTCCATGATCGGGAAAAGGTTTACACATAGTGAGCTTGCTTCTGCAACACGAAATTTCAAGAATCTGATAGGAGAAGGGAACTTCGGATGTGTTTATAAGGGTGTACTAAAATCCGGAGAAATGGTCGCTGTAAAGCAGCTAAAGGAAAAATA...

Protein

Download Protein FASTA

328 aa · TkA07G269960|TK1151|PROTEIN

MNWFFSCSNSKDDETDLRVNLLAAHEKGETCDDVTKSMIGKRFTHSELASATRNFKNLIGEGNFGCVYKGVLKSGEMVAVKQLKEKYNLKFNVDAHALMFSHSNLVTLIDYCTDGDKKFLVSEYMPLGSLQNHLFDLKPKQKPIDWSTRLKIAVGVARGLEYLHCKTNPPVIYRYMRSSNILLDNDFNPKLSDFGVVEDESNARHYVPVLGYCTPEYLGAFKWTLKSDIYSFGVVLLELITGRKAFDDTKKQEERCLVDW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G269960`
TK1151 ID	TkA07G269960
OH-1004 ID	LXL04_029075
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G269960

Location Chr07:67495123-67497363 (+)

Description Similar to PBL21: Probable serine/threonine-protein kinase PBL21

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g20650`	May be involved in plant defense signaling.	No verified direct reference in this release
`At5g02800`	Serine/threonine-protein kinase involved in the positive regulation of brassinosteroid (BR) signaling and plant growth.	No verified direct reference in this release
`At5g18610`	May act as a receptor-like cytoplasmic kinase in chitin-induced immune signaling.	Selective regulation of the chitin-induced defense response by the Arabidopsis receptor-like cytoplasmic kinase PBL27.2014 · DOI: 10.1111/tpj.12535 The Arabidopsis CERK1-associated kinase PBL27 connects chitin perception to MAPK activation.2016 · DOI: 10.15252/embj.201694248
`At1g76370`	May be involved in plant defense signaling.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0372100`	Functions as an immediate downstream signaling partner of CERK1 in the microbial peptidoglycans (PGNs) and fungal chitin signaling pathways that mediate innate immunity.	A receptor-like cytoplasmic kinase targeted by a plant pathogen effector is directly phosphorylated by the chitin receptor and mediates rice immunity.2013 · DOI: 10.1016/j.chom.2013.02.007

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029075 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002758 innate immune response-activating signaling pathway Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0043410 positive regulation of MAPK cascade Biological Process

GO:0045087 innate immune response Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0071323 cellular response to chitin Biological Process

GO:1900150 regulation of defense response to fungus Biological Process

GO:1900426 positive regulation of defense response to bacterium Biological Process

KEGG gene cross-reference

ath:AT1G20650

ath:AT1G76370

ath:AT5G02800

ath:AT5G18610

dosa:Os05g0372100

osa:4338592

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.693

Rank 1 · TkA07G269960 · TK1151

Cytoplasm0.228

Rank 2 · TkA07G269960 · TK1151

Nucleus0.201

Rank 3 · TkA07G269960 · TK1151

Endoplasmic reticulum0.043

Rank 4 · TkA07G269960 · TK1151

Golgi apparatus0.026

Rank 5 · TkA07G269960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr55-313 aa

PF00069Pkinase56-255 aa

PF03109ABC159-102 aa

PF03109ABC1178-201 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G269960	`PF07714`	PK_Tyr_Ser-Thr	55	313	9.7e-37	127.4
TkA07G269960	`PF00069`	Pkinase	56	255	6.3e-37	128.1
TkA07G269960	`PF03109`	ABC1	59	102	0.0019	18.1
TkA07G269960	`PF03109`	ABC1	178	201	0.0019	18.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LDZ5`	Arabidopsis thaliana	sp\|Q9LDZ5\|PBL21_ARATH Probable serine/threonine-protein kinase PBL21	54.600%	Swiss-Prot	High
`Q0WRY5`	Arabidopsis thaliana	sp\|Q0WRY5\|PBL7_ARATH Probable serine/threonine-protein kinase PBL7	50.300%	Swiss-Prot	High
`Q1PDV6`	Arabidopsis thaliana	sp\|Q1PDV6\|PBL27_ARATH Serine/threonine-protein kinase PBL27	52.700%	Swiss-Prot	High
`Q9SFX0`	Arabidopsis thaliana	sp\|Q9SFX0\|PBL22_ARATH Probable serine/threonine-protein kinase PBL22	52.900%	Swiss-Prot	High
`Q6I5Q6`	Oryza sativa subsp. japonica	sp\|Q6I5Q6\|RK185_ORYSJ Receptor-like cytoplasmic kinase 185	52.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card