Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2370 bp · TkA07G269770|TK1151|cDNA
ATTAAAACCCTCAAAAACCCTAACGTTGAGATGTTTTTAATCGAAAAATCTTTTCTCTCTCCTCGCCTATCTCTCCTCCGCCCCCCTCCTCATCCTCATCCGTGGTCTACCTCGCCGTCACGTAATTACAGATATTCCGAAAGAAACATCTAGAAGAAACTTTCCAGTCAAACGGGTACATTCCACATCAATCATGGCAGCTGCAAATGAAGATAATATAGGGAGCCTCAAAGAACAAATAGCAAAAGTATTTGAGGTCT...
1842 bp · TkA07G269770|TK1151|CDS
ATGGCAGCTGCAAATGAAGATAATATAGGGAGCCTCAAAGAACAAATAGCAAAAGTATTTGAGGTCTCACTGAGAGTTACAGTACCTCAAGAGTCAGATGTGGCGCCTTTAATTGCTCCATGTGCCAAAAAGGAATTCGGTGATTACCAATGCAACAATGCCATGAGCTTATGGGCTAAAATAAAAGGAAAGGGTACAGATTTTAAAGGTCCACAACCAGTTGGACAGGCCATCATGCGAAATCTTCCAGCATCTGACAT...
Protein
Download Protein FASTA613 aa · TkA07G269770|TK1151|PROTEIN
MAAANEDNIGSLKEQIAKVFEVSLRVTVPQESDVAPLIAPCAKKEFGDYQCNNAMSLWAKIKGKGTDFKGPQPVGQAIMRNLPASDMIESCSIAGPGFVNVKLSREWIAKTIQKMLTDGIDTWAPKLPVKRAIVDFSSPNIAKEMHVGHLRSTIIGDTLARMLEYSKVDVLRRNHVGDWGTQFGMLIEFLFEKFPSGEVNDQAIGELELFYKASKQRFDSDAEFKERAQQAVVSLQGGDEKYRKAWAQICEISRKGYQKV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G269770 |
|---|---|
| TK1151 ID | TkA07G269770 |
| OH-1004 ID | LXL04_029072 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 91.200 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 94.118Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G269770 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:67434429-67438980 (-) | |||||||||
| Description | Similar to EMB1027: Arginine--tRNA ligase, chloroplastic/mitochondrial | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006420 arginyl-tRNA aminoacylation Biological Process GO:0009791 post-embryonic development Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0048608 reproductive structure development Biological Process GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0009570 chloroplast stroma Cellular Component GO:0004814 arginine-tRNA ligase activity Molecular Function GO:0005524 ATP binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G66530 ath:AT4G26300 syc:syc0034_c syf:Synpcc7942_1577 tel:tll0826 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF23050KH_N4BP1_1st3-67 aaPF03485Arg_tRNA_synt_N14-103 aaPF03485Arg_tRNA_synt_N108-141 aaPF00750tRNA-synt_1d129-421 aaPF01406tRNA-synt_1e140-170 aaPF23050KH_N4BP1_1st225-245 aaPF10043DUF2279430-501 aaPF00750tRNA-synt_1d451-484 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G269770 | PF23050 | KH_N4BP1_1st | 3 | 67 | 0.099 | 13.4 |
| TkA07G269770 | PF03485 | Arg_tRNA_synt_N | 14 | 103 | 1.5e-16 | 61.5 |
| TkA07G269770 | PF03485 | Arg_tRNA_synt_N | 108 | 141 | 1.5e-16 | 61.5 |
| TkA07G269770 | PF00750 | tRNA-synt_1d | 129 | 421 | 3.9e-114 | 382.0 |
| TkA07G269770 | PF01406 | tRNA-synt_1e | 140 | 170 | 0.18 | 11.9 |
| TkA07G269770 | PF23050 | KH_N4BP1_1st | 225 | 245 | 0.099 | 13.4 |
| TkA07G269770 | PF10043 | DUF2279 | 430 | 501 | 0.23 | 12.9 |
| TkA07G269770 | PF00750 | tRNA-synt_1d | 451 | 484 | 3.9e-114 | 382.0 |
| TkA07G269770 | PF05746 | DALR_1 | 498 | 612 | 2.5e-34 | 118.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.