TkA07G268780 | RubberDandelionOmics

Gene overview

TkA07G268780

Reference: TK1151 Chr: Chr07 Coordinates: 67145388-67146825 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1280 bp · TkA07G268780|TK1151|cDNA

TAAACACCTGTTCCCGCTCACTCAATTCATTTTCCCTCGCATTTATCTTCACCCTCTAGGGTTTTCAAAACCCTAAGTCACTACAATCACGCTTCAGGCGATCAAAACTATGGCGGTCAATCTTACTGCTGATGCGATACCGATGATAACGACTGGGGAATGGCAAACGGTGGATCTGAAACCGGTGCTTCAGGTGATCGCTCTTCGGACTGTTCAAACGCAAACTTTGACAGAGGGTGGTGGAGAAAACAGGGAGATGC...

CDS

Download CDS FASTA

951 bp · TkA07G268780|TK1151|CDS

ATGGCGGTCAATCTTACTGCTGATGCGATACCGATGATAACGACTGGGGAATGGCAAACGGTGGATCTGAAACCGGTGCTTCAGGTGATCGCTCTTCGGACTGTTCAAACGCAAACTTTGACAGAGGGTGGTGGAGAAAACAGGGAGATGCACAGGGTATTGCTATCTGACGGTTCCTTTCATCGGCAGGGAGTCCTCTCTACTCATCGCAACGAGTTGGTTACCTCTCAACAGTTGCAGAGGGGTTCCATCGTTCAATT...

Protein

Download Protein FASTA

316 aa · TkA07G268780|TK1151|PROTEIN

MAVNLTADAIPMITTGEWQTVDLKPVLQVIALRTVQTQTLTEGGGENREMHRVLLSDGSFHRQGVLSTHRNELVTSQQLQRGSIVQLTEFVCITIRERLIIKIIDLNVILTQCDIIGDTRPFQLEPPGNDQFIWKTTSQIKDEELGTSGNPDYITVNATIWYIKRDKFWYTTCPIMLGDRKCSKKVVKNGDGRWRCMKCDQIVDECDYRYELHLQIRDHTGVAWITAYDHTAEEIMGVSAKDLYLLKQEEEGEDGFMETV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G268780`
TK1151 ID	TkA07G268780
OH-1004 ID	LXL04_029062
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G268780

Location Chr07:67145388-67146825 (-)

Description Similar to RPA1E: Replication protein A 70 kDa DNA-binding subunit E

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g19130`	Component of the replication protein A complex (RPA) required for DNA recombination, repair and replication.	No verified direct reference in this release
`At5g45400`	Component of the replication protein A complex (RPA) required for DNA recombination, repair and replication.	No verified direct reference in this release
`At2g06510`	Component of the replication protein A complex (RPA) required for DNA recombination, repair and replication.	Replication protein A (AtRPA1a) is required for class I crossover formation but is dispensable for meiotic DNA break repair.2009 · DOI: 10.1038/emboj.2008.295 Arabidopsis replication protein A 70a is required for DNA damage response and telomere length homeostasis.2009 · DOI: 10.1093/pcp/pcp140

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0776800`	Component of the replication protein A complex (RPA) required for DNA recombination, repair and replication.	Two types of replication protein A in seed plants.2005 · DOI: 10.1111/j.1742-4658.2005.04719.x Replication protein A (RPA1a) is required for meiotic and somatic DNA repair but is dispensable for DNA replication and homologous recombination in rice.2009 · DOI: 10.1104/pp.109.142877

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029062 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006260 DNA replication Biological Process

GO:0006289 nucleotide-excision repair Biological Process

GO:0007004 telomere maintenance via telomerase Biological Process

GO:0007131 reciprocal meiotic recombination Biological Process

GO:0007140 male meiotic nuclear division Biological Process

GO:0007141 male meiosis I Biological Process

GO:0009555 pollen development Biological Process

GO:0048232 male gamete generation Biological Process

GO:0051026 chiasma assembly Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0000785 chromatin Cellular Component

KEGG gene cross-reference

ath:AT2G06510

ath:AT4G19130

ath:AT5G45400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.891

Rank 1 · TkA07G268780 · TK1151

Cytoplasm0.208

Rank 2 · TkA07G268780 · TK1151

Mitochondrion0.025

Rank 3 · TkA07G268780 · TK1151

Cell membrane0.023

Rank 4 · TkA07G268780 · TK1151

Endoplasmic reticulum0.015

Rank 5 · TkA07G268780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04057Rep-A_N5-109 aa

PF17244CDC24_OB367-95 aa

PF08646Rep_fac-A_C153-304 aa

PF17244CDC24_OB3181-250 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G268780	`PF04057`	Rep-A_N	5	109	1.8e-19	70.4
TkA07G268780	`PF17244`	CDC24_OB3	67	95	0.0011	19.5
TkA07G268780	`PF08646`	Rep_fac-A_C	153	304	8.3e-45	152.9
TkA07G268780	`PF17244`	CDC24_OB3	181	250	0.0011	19.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JSG3`	Arabidopsis thaliana	sp\|F4JSG3\|RFA1E_ARATH Replication protein A 70 kDa DNA-binding subunit E	59.800%	Swiss-Prot	Medium
`Q9FHJ6`	Arabidopsis thaliana	sp\|Q9FHJ6\|RFA1C_ARATH Replication protein A 70 kDa DNA-binding subunit C	56.600%	Swiss-Prot	Medium
`Q9SKI4`	Arabidopsis thaliana	sp\|Q9SKI4\|RFA1A_ARATH Replication protein A 70 kDa DNA-binding subunit A	54.300%	Swiss-Prot	Medium
`Q6YZ49`	Oryza sativa subsp. japonica	sp\|Q6YZ49\|RFA1A_ORYSJ Replication protein A 70 kDa DNA-binding subunit A	47.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card