RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G268750
Reference: TK1151 Chr: Chr07 Coordinates: 67124332-67129459 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3289 bp · TkA07G268750|TK1151|cDNA

CTTTCTCGTTTTATATTGTCTTCCCGTTTCATATTCCATTTGAACTTTGTTGCTTCTGGGTTATTTGTTTTTCAGTATTTCTTCTTCTTCAATAGACATGGGAGAATCTACATGTCTCATGCCTTCAATATATGAACCCAACAAGGAAACAACCACGTAAGTCTCCGCAAATTCATCCACCACTTGTTCTTAATCCGATCGATTTCAAAGAAGAGAAAGAAACCAGCGTATCGGCTAGGCCTGTCGTAGGCAAAGTGGCT...

CDS

Download CDS FASTA

2184 bp · TkA07G268750|TK1151|CDS

ATGTCTCATATAACAGAGTTTGAACACCTCAAAATAAACTTAGAAGCCATAAAATCTGCAACCAACAACTTTGCTACTGAGAATTGTATTGGGAAAGGAGGATTTGGGAATGTGTATAAAGGAGAAATCGTCCATTCCAAAGGCAAGTGCATGGTTGCTTTTAAGCGATTAGACCGTGCATTTGGACAAGGAAACCCCGAGTTCTGGAAGGAAATCACAATGCTTTTTCAATACAAACATGAAAATTTGGTTCTCCTTTT...

Protein

Download Protein FASTA

727 aa · TkA07G268750|TK1151|PROTEIN

MSHITEFEHLKINLEAIKSATNNFATENCIGKGGFGNVYKGEIVHSKGKCMVAFKRLDRAFGQGNPEFWKEITMLFQYKHENLVLLLGFCDESDEKILVYNYACNRSLDFHLNNNDLTWTQRLKICLGIARGLAYLHSYEGGQVRVLHRDIKSSNILLNENWNAKISDFGLSKYAHANRFTFLFTSAVGTIGYCDPLYAETGLLTKESDVYSLGVVLFEVLCGRLCISNKDDRPLTVLARQCYELNKLDTIIFGNIRDEI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G268750
TK1151 IDTkA07G268750
OH-1004 IDLXL04_029204
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)68.500
Protein coverage (%)TK1151 55.983 / OH-1004 20.709
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G268750
LocationChr07:67124332-67129459 (+)
DescriptionSimilar to TPR2: Protein TOPLESS-RELATED PROTEIN 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g15750 Transcriptional corepressor. No verified direct reference in this release
At1g80490 Transcriptional corepressor.
Arabidopsis resistance protein SNC1 activates immune responses through association with a transcriptional corepressor.2010 · DOI: 10.1073/pnas.1002828107
At3g15880 Transcription corepressor of Zinc finger transcription factors GAF1/IDD2 and ENY/IDD1 in regulation of gibberellin homeostasis and signaling. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os08g0162100 Transcriptional corepressor involved in branch formation regulation, presumably by suppressing primary branch formation and promoting secondary branch formation.
OsLIS-L1 encoding a lissencephaly type-1-like protein with WD40 repeats is required for plant height and male gametophyte formation in rice.2012 · DOI: 10.1007/s00425-011-1532-7
Os03g0254700 Probable downstream regulator of strigolactones signaling (By similarity).
MODD Mediates Deactivation and Degradation of OsbZIP46 to Negatively Regulate ABA Signaling and Drought Resistance in Rice.2016 · DOI: 10.1105/tpc.16.00171
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_029204 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0009733 response to auxin Biological Process
GO:0009867 jasmonic acid mediated signaling pathway Biological Process
GO:0010051 xylem and phloem pattern formation Biological Process
GO:0010072 primary shoot apical meristem specification Biological Process
GO:0010229 inflorescence development Biological Process
GO:0045892 negative regulation of DNA-templated transcription Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0042802 identical protein binding Molecular Function
GO:0042803 protein homodimerization activity Molecular Function
KEGG gene cross-reference
ath:AT1G15750
dosa:Os08g0162100
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.577
Rank 1 · TkA07G268750 · TK1151
Nucleus0.370
Rank 2 · TkA07G268750 · TK1151
Cell membrane0.177
Rank 3 · TkA07G268750 · TK1151
Endoplasmic reticulum0.052
Rank 4 · TkA07G268750 · TK1151
Lysosome / Vacuole0.046
Rank 5 · TkA07G268750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase26-289 aa
PF07714PK_Tyr_Ser-Thr27-290 aa
PF23414Beta-prop_EML_2388-517 aa
PF24805EIF3I388-434 aa
PF25174Beta-prop_THOC3390-554 aa
PF25175Beta-prop_WDR5390-428 aa
PF24807WD40_CDC20-Fz390-435 aa
PF00400WD40391-413 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G268750PF00069Pkinase262891.4e-42146.6
TkA07G268750PF07714PK_Tyr_Ser-Thr272903.5e-40138.7
TkA07G268750PF23414Beta-prop_EML_23885172e-2074.0
TkA07G268750PF24805EIF3I3884343.3e-0833.8
TkA07G268750PF25174Beta-prop_THOC33905542.7e-2383.0
TkA07G268750PF25175Beta-prop_WDR53904287.8e-2278.6
TkA07G268750PF24807WD40_CDC20-Fz3904352.3e-1764.0
TkA07G268750PF00400WD403914133e-2072.5
TkA07G268750PF24814WD40_Prp193914283.4e-1969.7
TkA07G268750PF23381Beta-prop_IFT122_1st3914483.8e-1866.5
TkA07G268750PF24805EIF3I3915143.3e-0833.8
TkA07G268750PF25171Beta-prop_WDR36-Utp21_1st3914305.1e-0833.4
TkA07G268750PF23609Beta-prop_EIPR13914277.5e-0626.3
TkA07G268750PF23409Beta-prop_EML3924281e-0939.0
TkA07G268750PF23775Beta-prop_RIG_2nd3925511.3e-0525.5
TkA07G268750PF23383Beta-prop_IFT140_1st3924300.001618.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q94AI7Arabidopsis thalianasp|Q94AI7|TPL_ARATH Protein TOPLESS55.900%Swiss-ProtMedium
Q0WV90Arabidopsis thalianasp|Q0WV90|TPR1_ARATH Topless-related protein 155.200%Swiss-ProtMedium
Q27GK7Arabidopsis thalianasp|Q27GK7|TPR4_ARATH Topless-related protein 453.400%Swiss-ProtMedium
Q0J7U6Oryza sativa subsp. japonicasp|Q0J7U6|TPR2_ORYSJ Protein TOPLESS-RELATED PROTEIN 263.000%Swiss-ProtMedium
Q10NY2Oryza sativa subsp. japonicasp|Q10NY2|TPR3_ORYSJ Protein TPR357.100%Swiss-ProtMedium

JBrowse

View in Genome Browser