RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G268070
Reference: TK1151 Chr: Chr07 Coordinates: 66938265-66941231 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2503 bp · TkA07G268070|TK1151|cDNA

GTTCTCCTTTTCATTTTCCCCCGCTTTTATATTCATTCTCTACTAGTCTCTAGGGTTTTCTAAATCCCAAATCATTTCAATTCATCTTCATCAGATCAACACTATGGCGGTTAATCTTACTGCCGGCGCAATATCTTTACTAACGAGCGGGGAATGGCAAAAAATGGATCTGAAACCGGTGCTTCAGTTGATGGATCTTCGGATGGTTCAGACGCAAAATACGACAGGAGGTGGTGCAAACAACAAGGGGGATAAGTACC...

CDS

Download CDS FASTA

2121 bp · TkA07G268070|TK1151|CDS

ATGGCGGTTAATCTTACTGCCGGCGCAATATCTTTACTAACGAGCGGGGAATGGCAAAAAATGGATCTGAAACCGGTGCTTCAGTTGATGGATCTTCGGATGGTTCAGACGCAAAATACGACAGGAGGTGGTGCAAACAACAAGGGGGATAAGTACCGGGTTCTGTTATCCGACGGTTCTTTCCATCAGCAAGGGATGCTTGCTACTCAACTTAATGACTTGGTCACCTCTCATAAGATGCAGAAGGGTTCAATTGTTCA...

Protein

Download Protein FASTA

706 aa · TkA07G268070|TK1151|PROTEIN

MAVNLTAGAISLLTSGEWQKMDLKPVLQLMDLRMVQTQNTTGGGANNKGDKYRVLLSDGSFHQQGMLATQLNDLVTSHKMQKGSIVQLNQFVCNTIRGRLIIIIVDLNVILDKCDIIGDAKPFSQNLPGGEPSSMARPAPPIQSPFNQRPTTFSEDPPTGSVIRPHSNVTPPSHTPDYKPNLPAGNNYMPPVQPPPPNRPPPMYTNRGPVVKNDAPPRILPISALNPYQGRWTIKARVTSKGELRRYNNAKGDGKVFSFD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G268070
TK1151 IDTkA07G268070
OH-1004 IDLXL04_029061
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)95.900
Protein coverage (%)TK1151 100.000 / OH-1004 85.468
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G268070
LocationChr07:66938265-66941231 (+)
DescriptionSimilar to RPA1E: Replication protein A 70 kDa DNA-binding subunit E
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g19130 Component of the replication protein A complex (RPA) required for DNA recombination, repair and replication. No verified direct reference in this release
At2g06510 Component of the replication protein A complex (RPA) required for DNA recombination, repair and replication.
Replication protein A (AtRPA1a) is required for class I crossover formation but is dispensable for meiotic DNA break repair.2009 · DOI: 10.1038/emboj.2008.295
Arabidopsis replication protein A 70a is required for DNA damage response and telomere length homeostasis.2009 · DOI: 10.1093/pcp/pcp140
At5g45400 Component of the replication protein A complex (RPA) required for DNA recombination, repair and replication. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os02g0776800 Component of the replication protein A complex (RPA) required for DNA recombination, repair and replication.
Two types of replication protein A in seed plants.2005 · DOI: 10.1111/j.1742-4658.2005.04719.x
Replication protein A (RPA1a) is required for meiotic and somatic DNA repair but is dispensable for DNA replication and homologous recombination in rice.2009 · DOI: 10.1104/pp.109.142877
Os05g0111000 Component of the replication protein A complex (RPA) required for DNA recombination, repair and replication. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_029061 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000724 double-strand break repair via homologous recombination Biological Process
GO:0006260 DNA replication Biological Process
GO:0006281 DNA repair Biological Process
GO:0006289 nucleotide-excision repair Biological Process
GO:0007004 telomere maintenance via telomerase Biological Process
GO:0007131 reciprocal meiotic recombination Biological Process
GO:0007140 male meiotic nuclear division Biological Process
GO:0007141 male meiosis I Biological Process
GO:0009555 pollen development Biological Process
GO:0048232 male gamete generation Biological Process
GO:0051026 chiasma assembly Biological Process
GO:0051321 meiotic cell cycle Biological Process
KEGG gene cross-reference
ath:AT2G06510
ath:AT4G19130
ath:AT5G45400
dosa:Os02g0776800
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.945
Rank 1 · TkA07G268070 · TK1151
Cytoplasm0.175
Rank 2 · TkA07G268070 · TK1151
Mitochondrion0.024
Rank 3 · TkA07G268070 · TK1151
Cell membrane0.020
Rank 4 · TkA07G268070 · TK1151
Endoplasmic reticulum0.012
Rank 5 · TkA07G268070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04057Rep-A_N5-110 aa
PF02721DUF223224-328 aa
PF01336tRNA_anti-codon232-315 aa
PF16900REPA_OB_2259-284 aa
PF08646Rep_fac-A_C266-282 aa
PF13696zf-CCHC_2323-326 aa
PF16900REPA_OB_2342-446 aa
PF01336tRNA_anti-codon380-409 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G268070PF04057Rep-A_N51106e-2691.1
TkA07G268070PF02721DUF2232243280.0004521.1
TkA07G268070PF01336tRNA_anti-codon2323152.5e-1144.1
TkA07G268070PF16900REPA_OB_22592849.2e-30103.2
TkA07G268070PF08646Rep_fac-A_C2662822.5e-47161.0
TkA07G268070PF13696zf-CCHC_23233260.0005720.3
TkA07G268070PF16900REPA_OB_23424469.2e-30103.2
TkA07G268070PF01336tRNA_anti-codon3804092.5e-1144.1
TkA07G268070PF08646Rep_fac-A_C5016452.5e-47161.0
TkA07G268070PF13187Fer4_95175570.8710.4
TkA07G268070PF13917zf-CCHC_35425470.05214.1
TkA07G268070PF01336tRNA_anti-codon5625822.5e-1144.1
TkA07G268070PF13917zf-CCHC_36847020.05214.1
TkA07G268070PF00098zf-CCHC6887037.1e-0729.7
TkA07G268070PF13696zf-CCHC_26887030.0005720.3
TkA07G268070PF13187Fer4_96896940.8710.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
F4JSG3Arabidopsis thalianasp|F4JSG3|RFA1E_ARATH Replication protein A 70 kDa DNA-binding subunit E51.200%Swiss-ProtHigh
Q9SKI4Arabidopsis thalianasp|Q9SKI4|RFA1A_ARATH Replication protein A 70 kDa DNA-binding subunit A50.400%Swiss-ProtHigh
Q9FHJ6Arabidopsis thalianasp|Q9FHJ6|RFA1C_ARATH Replication protein A 70 kDa DNA-binding subunit C45.900%Swiss-ProtMedium
Q6YZ49Oryza sativa subsp. japonicasp|Q6YZ49|RFA1A_ORYSJ Replication protein A 70 kDa DNA-binding subunit A48.200%Swiss-ProtMedium
Q65XV7Oryza sativa subsp. japonicasp|Q65XV7|RFA1C_ORYSJ Replication protein A 70 kDa DNA-binding subunit C41.100%Swiss-ProtMedium

JBrowse

View in Genome Browser