TkA07G266530 | RubberDandelionOmics

Gene overview

TkA07G266530

Reference: TK1151 Chr: Chr07 Coordinates: 66600400-66601911 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

695 bp · TkA07G266530|TK1151|cDNA

TACTCCCGTTTTAACATTCGTAGGAGGAGATGCGAACGAGATCAACGAGAAAGTCATCGGCGGCAAATATTCTGATGACGCCGCAGTCGCTGCTGGCGACTCCAACTCAATCACCGAGTGAATCTCCGGAGATTTTAAAATCTAATTCTAGCCACTTCACTACACCTACAAATTCGCCCTCGTCTCTAAAGGGGGATCGTAGAAGCAACCAGAACAACAGGAAAGTAGCTGCAGCAGAGCCGCTCAACGCAACATCTCCA...

CDS

Download CDS FASTA

627 bp · TkA07G266530|TK1151|CDS

ATGCGAACGAGATCAACGAGAAAGTCATCGGCGGCAAATATTCTGATGACGCCGCAGTCGCTGCTGGCGACTCCAACTCAATCACCGAGTGAATCTCCGGAGATTTTAAAATCTAATTCTAGCCACTTCACTACACCTACAAATTCGCCCTCGTCTCTAAAGGGGGATCGTAGAAGCAACCAGAACAACAGGAAAGTAGCTGCAGCAGAGCCGCTCAACGCAACATCTCCAGTGATTTCACCGAGTAAAACATGTAATAG...

Protein

Download Protein FASTA

208 aa · TkA07G266530|TK1151|PROTEIN

MRTRSTRKSSAANILMTPQSLLATPTQSPSESPEILKSNSSHFTTPTNSPSSLKGDRRSNQNNRKVAAAEPLNATSPVISPSKTCNSLSDLKKLTSSRINAIKRQIDCSYSDILNDMEISHSRLQKRYKVQTQACKQTMDEVEKDFKKMIDHMSQTHDAMEASYTDLIAETQARSTRLCKTTIAGLSQSVDKAIEALRSHYGPASVSS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G266530`
TK1151 ID	TkA07G266530
OH-1004 ID	LXL04_025873
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	65.700
Protein coverage (%)	TK1151 33.654 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G266530`
Location	Chr07:66600400-66601911 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_025873` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.913

Rank 1 · TkA07G266530 · TK1151

Cytoplasm0.217

Rank 2 · TkA07G266530 · TK1151

Mitochondrion0.025

Rank 3 · TkA07G266530 · TK1151

Cell membrane0.014

Rank 4 · TkA07G266530 · TK1151

Golgi apparatus0.007

Rank 5 · TkA07G266530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20388DUF668336-91 aa

PF20388DUF668374-173 aa

PF04009DUF35682-157 aa

PF20667Sec10_N83-107 aa

PF25448DUF789783-200 aa

PF19793DUF627785-146 aa

PF02601Exonuc_VII_L88-196 aa

PF00453Ribosomal_L2089-127 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G266530	`PF20388`	DUF6683	36	91	0.56	10.5
TkA07G266530	`PF20388`	DUF6683	74	173	0.56	10.5
TkA07G266530	`PF04009`	DUF356	82	157	0.14	13.2
TkA07G266530	`PF20667`	Sec10_N	83	107	0.0093	16.8
TkA07G266530	`PF25448`	DUF7897	83	200	0.044	12.9
TkA07G266530	`PF19793`	DUF6277	85	146	0.27	12.2
TkA07G266530	`PF02601`	Exonuc_VII_L	88	196	0.27	11.4
TkA07G266530	`PF00453`	Ribosomal_L20	89	127	0.0084	16.9
TkA07G266530	`PF05615`	THOC7	91	177	0.091	13.8
TkA07G266530	`PF13250`	SNIPE	91	128	0.15	12.6
TkA07G266530	`PF27241`	CLIP1	92	198	0.014	16.2
TkA07G266530	`PF06103`	DUF948	95	108	0.63	11.0
TkA07G266530	`PF28231`	STB2_C	104	178	0.2	12.8
TkA07G266530	`PF04344`	CheZ	105	195	0.27	11.8
TkA07G266530	`PF20667`	Sec10_N	122	177	0.0093	16.8
TkA07G266530	`PF11157`	DUF2937	130	182	0.46	11.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card