TkA07G265120 | RubberDandelionOmics

Gene overview

TkA07G265120

Reference: TK1151 Chr: Chr07 Coordinates: 66246726-66248403 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

992 bp · TkA07G265120|TK1151|cDNA

TTGATATATAACTCGGATCAAGCTTCTAACCGAGCAAATCACACTCAGTCACTCACCATACCATGGAGCACGACGGCGTTGGTGCCCTCCGTACCCGATCGAAGGTGGCGCCCGATTGGACCGTAGAGGAATCCCTAATTCTGGTGAACGAGGTCTCTGCTGTGGAAGGTGATTGCGGCGACACGCTCGCTTCCTTCCAGAAATGGAAGATCATTGTCGAGAATTGCAACGCGTTGGGTGTAAATCGCAACCTGAATCAG...

CDS

Download CDS FASTA

768 bp · TkA07G265120|TK1151|CDS

ATGGAGCACGACGGCGTTGGTGCCCTCCGTACCCGATCGAAGGTGGCGCCCGATTGGACCGTAGAGGAATCCCTAATTCTGGTGAACGAGGTCTCTGCTGTGGAAGGTGATTGCGGCGACACGCTCGCTTCCTTCCAGAAATGGAAGATCATTGTCGAGAATTGCAACGCGTTGGGTGTAAATCGCAACCTGAATCAGTGTCGAAGGAAGTGGGACTCTTTGCTCTCCGATTACAAGAAAATCAAACAGTCAGGCTCGAA...

Protein

Download Protein FASTA

255 aa · TkA07G265120|TK1151|PROTEIN

MEHDGVGALRTRSKVAPDWTVEESLILVNEVSAVEGDCGDTLASFQKWKIIVENCNALGVNRNLNQCRRKWDSLLSDYKKIKQSGSKKVSFNTDLLKVIEWYVRDYEGGCDTDPDSDPEAVPEPEPEPEPVLASFLQSASKKQRSKTLPQKRSIEETPKPKKPIKTQELKREEYSSEPRNDILNIVTRPEEISNEKQEQIMAEKLRENADLIEAIVKQDLTNGGSSEELTRVNGDKLIVCLSNLVVALDRLSKFV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G265120`
TK1151 ID	TkA07G265120
OH-1004 ID	LXL04_006068
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	32.300
Protein coverage (%)	TK1151 38.039 / OH-1004 25.063 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G265120`
Location	Chr07:66246726-66248403 (-)
Description	Similar to GT-1: Trihelix transcription factor GT-1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_006068` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0019760 glucosinolate metabolic process Biological Process GO:0048354 mucilage biosynthetic process involved in seed coat development Biological Process GO:0048358 mucilage pectin biosynthetic process Biological Process GO:0048768 root hair cell tip growth Biological Process GO:0005634 nucleus Cellular Component GO:0005730 nucleolus Cellular Component GO:0016592 mediator complex Cellular Component GO:0000976 transcription cis-regulatory region binding Molecular Function GO:0000987 cis-regulatory region sequence-specific DNA binding Molecular Function GO:0003677 DNA binding Molecular Function
KEGG gene cross-reference	ath:AT1G13450 ath:AT1G76880 ath:AT2G38250 ath:AT3G25990 ath:AT5G01380 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.963

Rank 1 · TkA07G265120 · TK1151

Cytoplasm0.089

Rank 2 · TkA07G265120 · TK1151

Cell membrane0.023

Rank 3 · TkA07G265120 · TK1151

Endoplasmic reticulum0.012

Rank 4 · TkA07G265120 · TK1151

Plastid0.011

Rank 5 · TkA07G265120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13873Myb_DNA-bind_517-32 aa

PF13837Myb_DNA-bind_418-89 aa

PF00249Myb_DNA-binding18-74 aa

PF13921Myb_DNA-bind_619-82 aa

PF12776Myb_DNA-bind_340-84 aa

PF13873Myb_DNA-bind_546-81 aa

PF05887Trypan_PARP108-141 aa

PF13873Myb_DNA-bind_5195-213 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G265120	`PF13873`	Myb_DNA-bind_5	17	32	0.00051	20.7
TkA07G265120	`PF13837`	Myb_DNA-bind_4	18	89	2.7e-12	47.7
TkA07G265120	`PF00249`	Myb_DNA-binding	18	74	0.001	19.9
TkA07G265120	`PF13921`	Myb_DNA-bind_6	19	82	0.00026	21.8
TkA07G265120	`PF12776`	Myb_DNA-bind_3	40	84	0.19	13.4
TkA07G265120	`PF13873`	Myb_DNA-bind_5	46	81	0.00051	20.7
TkA07G265120	`PF05887`	Trypan_PARP	108	141	4.4	8.0
TkA07G265120	`PF13873`	Myb_DNA-bind_5	195	213	0.00051	20.7
TkA07G265120	`PF12776`	Myb_DNA-bind_3	196	196	0.19	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card