TkA07G264470 | RubberDandelionOmics

Gene overview

TkA07G264470

Reference: TK1151 Chr: Chr07 Coordinates: 66113147-66117214 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2372 bp · TkA07G264470|TK1151|cDNA

GAAAGAAAAAGATAAACATGACTAATTAATGGTTATCCTTTTTTATTTCGAACATCAAGCTTGAAGCCCTCAACTTTGTTTCCAGTCACTTATCTTTCTACCATCAAAATGACGCACCTCACAAATAAATTTGAACACTTGAAGATACAGTTAGAAGCTATAAAATTAGCGACCAACAACTTTGCTGACGAAAATTGCATCGGTAGAGGAGGTTTTGGTAAAGTATATAAGGGAGAGCTTTTTCACTCCGGTGGGCAAAT...

CDS

Download CDS FASTA

1020 bp · TkA07G264470|TK1151|CDS

ATGACGCACCTCACAAATAAATTTGAACACTTGAAGATACAGTTAGAAGCTATAAAATTAGCGACCAACAACTTTGCTGACGAAAATTGCATCGGTAGAGGAGGTTTTGGTAAAGTATATAAGGGAGAGCTTTTTCACTCCGGTGGGCAAATAGTTGTTGCTTTAAAGAGATTAGATCCAAAATTTGGGCAAGGAAACCCTGAGTTTTGGAAGGAGATCATCATGCTTTCTCAATACAAGCATGAAAATATTGTTTCGCT...

Protein

Download Protein FASTA

339 aa · TkA07G264470|TK1151|PROTEIN

MTHLTNKFEHLKIQLEAIKLATNNFADENCIGRGGFGKVYKGELFHSGGQIVVALKRLDPKFGQGNPEFWKEIIMLSQYKHENIVSLLGFCDESNEKILVYEYASRRSLDSYLNNDDLTWIRRLNICIGAARGLAYLHNPGETQQRVLHRDIKSSNILLDENWNAKISDLGLSKFGPANQQYTFLVSHAVGTFGYCDPVYIETGLLTKESDVYSFGVVLFEVLCGRLCISIKNESLIALVRKYYPQNKISDIIFGNIKDG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G264470`
TK1151 ID	TkA07G264470
OH-1004 ID	LXL04_028901
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	80.500
Protein coverage (%)	TK1151 92.920 / OH-1004 74.126 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G264470

Location Chr07:66113147-66117214 (-)

Description Similar to At5g39000: Putative receptor-like protein kinase At5g39000

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g46290`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
`At5g59700`	Probable receptor-like protein kinase At5g59700.	No verified direct reference in this release
`At5g39000`	Putative receptor-like protein kinase At5g39000.	No verified direct reference in this release
`At1g30570`	Probable receptor-like protein kinase At1g30570.	No verified direct reference in this release
`At5g38990`	Probable receptor-like protein kinase At5g38990.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028901 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010038 response to metal ion Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0043680 filiform apparatus Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G30570

ath:AT3G46290

ath:AT5G38990

ath:AT5G39000

ath:AT5G59700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.522

Rank 1 · TkA07G264470 · TK1151

Cytoplasm0.379

Rank 2 · TkA07G264470 · TK1151

Nucleus0.208

Rank 3 · TkA07G264470 · TK1151

Endoplasmic reticulum0.052

Rank 4 · TkA07G264470 · TK1151

Golgi apparatus0.049

Rank 5 · TkA07G264470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase27-291 aa

PF03109ABC127-60 aa

PF07714PK_Tyr_Ser-Thr29-293 aa

PF07718Coatamer_beta_C79-93 aa

PF01636APH140-164 aa

PF03109ABC1142-181 aa

PF07718Coatamer_beta_C181-212 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G264470	`PF00069`	Pkinase	27	291	3e-41	142.3
TkA07G264470	`PF03109`	ABC1	27	60	0.13	12.1
TkA07G264470	`PF07714`	PK_Tyr_Ser-Thr	29	293	4e-43	148.3
TkA07G264470	`PF07718`	Coatamer_beta_C	79	93	0.2	12.2
TkA07G264470	`PF01636`	APH	140	164	0.31	11.5
TkA07G264470	`PF03109`	ABC1	142	181	0.13	12.1
TkA07G264470	`PF07718`	Coatamer_beta_C	181	212	0.2	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LX66`	Arabidopsis thaliana	sp\|Q9LX66\|HERK_ARATH Receptor-like protein kinase HERK 1	45.700%	Swiss-Prot	Medium
`Q9FN92`	Arabidopsis thaliana	sp\|Q9FN92\|Y5597_ARATH Probable receptor-like protein kinase At5g59700	48.700%	Swiss-Prot	Medium
`Q9FID8`	Arabidopsis thaliana	sp\|Q9FID8\|Y5900_ARATH Putative receptor-like protein kinase At5g39000	44.600%	Swiss-Prot	Medium
`Q9SA72`	Arabidopsis thaliana	sp\|Q9SA72\|Y1357_ARATH Probable receptor-like protein kinase At1g30570	45.300%	Swiss-Prot	Medium
`Q9FID9`	Arabidopsis thaliana	sp\|Q9FID9\|Y5389_ARATH Probable receptor-like protein kinase At5g38990	42.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card