Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2619 bp · TkA07G264420|TK1151|cDNA
ATGATGAGTCGTGGAGCGACGACTGTAGTCCGATCCGGAAACGCATCCGTGACCGGGGTGATGAGAACCAACACTGGCCTCATTGGATCTGAAAAGGCGGTGGCGACATGGTGGATTAGATATTCTCCTATTGGTGCTCGCAATGCGAGTACCATGACATTGGGGGAGAAAGAACAGCAACAGGAGCATAAGGAAGAAGCAACAGGTAGCGGCGGCGCTGCCGCCGGTGGTCAGAAAGGTAAAGAAGTCGTGAGTTACTG...
1002 bp · TkA07G264420|TK1151|CDS
ATGATGAGTCGTGGAGCGACGACTGTAGTCCGATCCGGAAACGCATCCGTGACCGGGGTGATGAGAACCAACACTGGCCTCATTGGATCTGAAAAGGCGGTGGCGACATGGTGGATTAGATATTCTCCTATTGGTGCTCGCAATGCGAGTACCATGACATTGGGGGAGAAAGAACAGCAACAGGAGCATAAGGAAGAAGCAACAGGTAGCGGCGGCGCTGCCGCCGGTGGTCAGAAAGGTAAAGAAGTCGTGAGTTACTG...
Protein
Download Protein FASTA333 aa · TkA07G264420|TK1151|PROTEIN
MMSRGATTVVRSGNASVTGVMRTNTGLIGSEKAVATWWIRYSPIGARNASTMTLGEKEQQQEHKEEATGSGGAAAGGQKGKEVVSYWGVQPPKVTKEDGSEWKWHCFRPWETYQADLSIDLKKHHTPTTFLDKLAYWTVKSLRFPTDVFFQRRYGCRAMMLETVAAVPGMVGGMLLHCKSLRRFEPSGGWIKALLEEAENERMHLMTFMEVSKPRWYERALVFTVQGVFFNAYFLAYLASPKLAHRIVGYLEEEAIHSYT...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G264420 |
|---|---|
| TK1151 ID | TkA07G264420 |
| OH-1004 ID | LXL04_029036 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 97.100 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G264420 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:66098836-66101797 (+) | |||||||||
| Description | Similar to AOX1: Ubiquinol oxidase 1, mitochondrial | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009409 response to cold Biological Process GO:0010230 alternative respiration Biological Process GO:0022904 respiratory electron transport chain Biological Process GO:0031930 mitochondria-nucleus signaling pathway Biological Process GO:0045333 cellular respiration Biological Process GO:0005739 mitochondrion Cellular Component GO:0005743 mitochondrial inner membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0009916 alternative oxidase activity Molecular Function GO:0046872 metal ion binding Molecular Function GO:0102721 ubiquinol:oxygen oxidoreductase activity Molecular Function GO:0106292 superoxide-generating NADPH oxidase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT3G22360 ath:AT3G22370 gmx:547924 nta:107781761 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF24107DUF73825-29 aaPF01786AOX122-314 aaPF03232COQ7194-309 aaPF06480FtsH_ext258-275 aaPF24107DUF7382293-309 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G264420 | PF24107 | DUF7382 | 5 | 29 | 0.26 | 11.9 |
| TkA07G264420 | PF01786 | AOX | 122 | 314 | 1.3e-82 | 277.3 |
| TkA07G264420 | PF03232 | COQ7 | 194 | 309 | 0.002 | 18.5 |
| TkA07G264420 | PF06480 | FtsH_ext | 258 | 275 | 0.3 | 12.1 |
| TkA07G264420 | PF24107 | DUF7382 | 293 | 309 | 0.26 | 11.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.